Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2994
Gene name
LocationContig_1757:660..3194
Strand+
Gene length (bp)2534
Transcript length (bp)2415
Coding sequence length (bp)2415
Protein length (aa) 805

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-27 176 338
PF07690 MFS_1 Major Facilitator Superfamily 5.6E-10 572 744
PF00083 Sugar_tr Sugar (and other) transporter 7.4E-09 195 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 128 368 6.0E-28
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 146 749 1.0E-23
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 134 336 2.0E-23
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 104 361 9.0E-20
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 106 349 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 128 368 6.0E-28
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 146 749 1.0E-23
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 134 336 2.0E-23
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 104 361 9.0E-20
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 106 349 3.0E-19
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 127 345 3.0E-19
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 117 335 1.0E-18
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 122 335 1.0E-18
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 566 797 2.0E-18
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 1 358 2.0E-18
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 136 358 6.0E-16
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 105 335 6.0E-16
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 584 800 1.0E-15
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 163 354 2.0E-14
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 145 348 2.0E-14
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 142 344 4.0E-14
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 127 335 5.0E-14
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 134 368 1.0E-13
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 134 368 1.0E-13
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 136 363 3.0E-13
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 136 336 8.0E-13
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 136 336 8.0E-13
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 140 335 1.0E-11
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 74 348 1.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 536 753 3.0E-11
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 134 352 3.0E-11
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 125 335 3.0E-11
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 173 349 4.0E-11
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 142 344 4.0E-11
sp|P39386|MDTM_ECOLI Multidrug resistance protein MdtM OS=Escherichia coli (strain K12) GN=mdtM PE=1 SV=1 173 335 1.0E-10
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 598 753 2.0E-10
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 137 335 2.0E-10
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 598 753 3.0E-10
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 125 336 4.0E-10
sp|Q8XB84|MDTM_ECO57 Multidrug resistance protein MdtM OS=Escherichia coli O157:H7 GN=mdtM PE=3 SV=1 173 335 4.0E-10
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 139 362 5.0E-10
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 181 363 5.0E-10
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 573 749 2.0E-09
sp|Q7CP73|MDTM_SALTY Multidrug resistance protein MdtM OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtM PE=3 SV=1 173 335 6.0E-09
sp|Q8XFG0|MDTM_SALTI Multidrug resistance protein MdtM OS=Salmonella typhi GN=mdtM PE=3 SV=1 173 335 6.0E-09
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 657 753 1.0E-08
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 101 336 2.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 142 335 2.0E-08
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 180 326 3.0E-08
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 97 353 6.0E-08
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 183 336 7.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 621 792 1.0E-07
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 180 326 2.0E-07
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 574 790 3.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 180 326 3.0E-07
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 145 348 5.0E-07
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 579 792 2.0E-06
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 107 336 2.0E-06
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 180 355 3.0E-06
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 588 753 4.0E-06
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 83 348 4.0E-06
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 579 799 7.0E-06
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 175 333 1.0E-05
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 175 333 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 159 181 22
2 196 218 22
3 225 242 17
4 257 276 19
5 283 305 22
6 310 332 22
7 583 605 22
8 625 647 22
9 668 690 22
10 700 722 22
11 734 756 22
12 766 788 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2994
MEPGQDTAMSSSSEDLKDSPARWKMPRLFRGRRPDPDSPADHKPGHSKWSMGVLNDRETVEVPGSVLLLAADHNE
PLGLRNVHARTSHSSIPVGFPVDATLSPSSTRPSSHPQHQRQSEAESFGDKKLTSDGTIILDPQPEDSANDPLNW
PSWRRDTALLSLGFYCMIGGGITPIIAAGFTDVARDYHVDVETVPLTTGLYMMGLGLGSVIASPTAILFGKRPVY
LASAIVFIGTCLWAAWSPSFSSLLAARVFQGVAISPVECLPSATIAEIFFLHERAYRIGIYTLLLLGGKNLVPLV
SAAIISRFGWRWVFWIVAMVVGLGFVLLFLFVPETFWDRTPTRKPSKRPSILRRLSSRRSVQRTDVPSAGGRGSA
EKAPSPGIAARHRDLHVDFAPQQDAGRDGGGVETPRRPHTPNRHVEWAEAADSEKHADHGAPESQRPTAAQDQAS
LPHLGINVPVVQLSEDAHDVDEIKSVSSHGRRVSSPRPNAAAAAAAGQLDSLAVSPYSHHATGSESNIDYLSRGP
NLDEEKIPASALRAPPKVQAYTHNLRHQPAQTFLQQLRPYHGRLNHDNWFKVAVRPFILFAYPAVLWSAAVYACS
IGWLIVISETMAVIYRDPNVYNFNALQTGLVYISPFVGGILGTGVAGKVSDVIVRIMSRRNGGLYEPEFRLVMGL
PVLITTCMGLMGFGWSAQERDHWIVPTLFFGVLSFGCSLGSTTSITFCVDSYRQYAGEALVTLNFSKNVLHGLAF
SLFVSHWIAKDGPKQVYVWLGIIQLILMLFTVPLYIFGKRARMWTVRKNFMEKF*
Coding >Hirsu2|2994
ATGGAGCCGGGGCAGGACACGGCCATGTCTTCGTCTTCCGAAGACCTCAAGGACTCCCCCGCCCGCTGGAAGATG
CCCCGCCTCTTCCGCGGGCGGCGTCCTGACCCGGACTCGCCAGCCGACCACAAGCCGGGCCACTCGAAATGGAGC
ATGGGTGTCTTGAACGACAGGGAGACGGTCGAAGTCCCCGGCTCCGTCTTGCTGCTCGCCGCGGACCACAACGAG
CCGCTGGGCCTCCGCAACGTCCACGCCAGGACCTCGCACTCGTCTATCCCGGTCGGCTTCCCTGTCGACGCCACA
CTGAGCCCGAGCAGCACCCGGCCCTCGTCTCACCCTCAGCACCAGCGCCAGTCCGAGGCCGAGTCCTTCGGGGAC
AAGAAGCTGACTAGTGACGGCACCATCATCCTCGACCCCCAGCCCGAGGACTCGGCCAACGACCCGCTCAACTGG
CCCAGCTGGCGCCGCGACACGGCCCTGCTGTCTCTGGGTTTCTACTGCATGATCGGCGGCGGCATCACGCCCATC
ATCGCCGCCGGCTTCACCGACGTGGCCCGCGACTACCATGTCGACGTCGAGACCGTCCCCCTCACCACGGGTCTC
TACATGATGGGTCTTGGTTTGGGCTCGGTCATCGCGTCCCCCACGGCCATTTTGTTCGGCAAGCGTCCCGTCTAC
CTTGCTAGTGCCATCGTCTTCATCGGCACCTGCCTGTGGGCGGCATGGTCCCCCAGCTTCTCCTCCCTGCTGGCC
GCCAGGGTCTTTCAGGGCGTCGCCATCAGCCCGGTCGAGTGCCTCCCCTCCGCCACCATCGCCGAGATCTTCTTC
CTCCACGAGCGCGCCTACCGCATCGGCATCTACACCCTTCTGCTGCTGGGCGGCAAGAACCTGGTCCCCCTGGTC
AGCGCCGCCATCATAAGTCGCTTCGGCTGGCGCTGGGTCTTTTGGATCGTCGCCATGGTTGTCGGCCTCGGCTTC
GTTCTCCTCTTCCTCTTCGTCCCCGAGACCTTCTGGGACAGAACGCCGACCAGGAAGCCGTCCAAACGCCCGAGC
ATCCTTCGTCGCCTGTCGTCCCGCCGCAGCGTACAACGCACCGACGTGCCGTCGGCGGGCGGCCGCGGAAGCGCC
GAAAAGGCCCCGTCGCCCGGCATAGCGGCGCGCCACAGGGACCTCCACGTCGACTTCGCGCCCCAGCAGGATGCG
GGCCGGGACGGCGGCGGCGTCGAAACGCCGAGGAGGCCGCACACGCCAAATCGCCACGTGGAGTGGGCCGAGGCG
GCGGACTCGGAGAAGCATGCGGACCACGGAGCGCCGGAGTCGCAGCGCCCCACTGCGGCCCAGGATCAGGCGTCC
CTCCCGCACCTGGGCATCAACGTGCCGGTCGTGCAGCTGTCGGAGGACGCGCACGACGTGGACGAGATCAAGTCC
GTCTCGAGCCACGGCCGTCGCGTGTCGTCGCCGAGACCCAATGCCGCCGCCGCCGCCGCCGCCGGCCAGCTGGAC
AGCTTGGCCGTCTCGCCCTACTCGCATCACGCGACCGGGAGCGAGTCCAACATCGATTACCTCAGTAGGGGACCC
AATCTGGACGAGGAGAAGATACCGGCGTCTGCGCTCAGGGCGCCGCCAAAGGTGCAGGCGTACACGCATAATCTG
CGTCACCAGCCGGCGCAGACGTTCTTGCAGCAGCTGCGGCCGTACCACGGCCGGCTCAACCACGACAACTGGTTC
AAGGTGGCGGTCAGGCCCTTCATCCTGTTCGCCTACCCGGCGGTGCTCTGGTCGGCGGCCGTGTACGCCTGCTCG
ATCGGCTGGCTCATCGTCATCTCGGAGACGATGGCCGTCATCTACCGCGACCCGAACGTGTACAACTTCAACGCG
CTGCAGACGGGCCTCGTCTACATCTCGCCCTTCGTGGGCGGGATCCTGGGGACCGGGGTTGCGGGCAAGGTCAGC
GACGTCATCGTGCGGATCATGTCGCGGCGCAACGGCGGGCTCTACGAACCCGAGTTCCGGCTAGTCATGGGGCTA
CCGGTGCTGATCACGACGTGCATGGGGCTCATGGGCTTCGGCTGGTCAGCGCAGGAGCGCGACCACTGGATCGTG
CCGACGCTCTTCTTCGGCGTGCTGTCGTTCGGGTGCTCGCTGGGGTCGACGACGTCGATCACGTTCTGCGTCGAC
AGCTACCGCCAGTACGCGGGCGAGGCGCTGGTGACGCTCAACTTCTCCAAGAACGTGCTGCACGGCCTCGCCTTC
AGCCTGTTCGTGTCGCACTGGATTGCCAAGGATGGGCCCAAGCAGGTCTACGTGTGGCTGGGCATCATCCAGCTG
ATCCTGATGCTGTTCACGGTTCCCCTGTACATCTTCGGCAAGCGCGCGCGCATGTGGACGGTCAGGAAGAACTTT
ATGGAGAAGTTCTGA
Transcript >Hirsu2|2994
ATGGAGCCGGGGCAGGACACGGCCATGTCTTCGTCTTCCGAAGACCTCAAGGACTCCCCCGCCCGCTGGAAGATG
CCCCGCCTCTTCCGCGGGCGGCGTCCTGACCCGGACTCGCCAGCCGACCACAAGCCGGGCCACTCGAAATGGAGC
ATGGGTGTCTTGAACGACAGGGAGACGGTCGAAGTCCCCGGCTCCGTCTTGCTGCTCGCCGCGGACCACAACGAG
CCGCTGGGCCTCCGCAACGTCCACGCCAGGACCTCGCACTCGTCTATCCCGGTCGGCTTCCCTGTCGACGCCACA
CTGAGCCCGAGCAGCACCCGGCCCTCGTCTCACCCTCAGCACCAGCGCCAGTCCGAGGCCGAGTCCTTCGGGGAC
AAGAAGCTGACTAGTGACGGCACCATCATCCTCGACCCCCAGCCCGAGGACTCGGCCAACGACCCGCTCAACTGG
CCCAGCTGGCGCCGCGACACGGCCCTGCTGTCTCTGGGTTTCTACTGCATGATCGGCGGCGGCATCACGCCCATC
ATCGCCGCCGGCTTCACCGACGTGGCCCGCGACTACCATGTCGACGTCGAGACCGTCCCCCTCACCACGGGTCTC
TACATGATGGGTCTTGGTTTGGGCTCGGTCATCGCGTCCCCCACGGCCATTTTGTTCGGCAAGCGTCCCGTCTAC
CTTGCTAGTGCCATCGTCTTCATCGGCACCTGCCTGTGGGCGGCATGGTCCCCCAGCTTCTCCTCCCTGCTGGCC
GCCAGGGTCTTTCAGGGCGTCGCCATCAGCCCGGTCGAGTGCCTCCCCTCCGCCACCATCGCCGAGATCTTCTTC
CTCCACGAGCGCGCCTACCGCATCGGCATCTACACCCTTCTGCTGCTGGGCGGCAAGAACCTGGTCCCCCTGGTC
AGCGCCGCCATCATAAGTCGCTTCGGCTGGCGCTGGGTCTTTTGGATCGTCGCCATGGTTGTCGGCCTCGGCTTC
GTTCTCCTCTTCCTCTTCGTCCCCGAGACCTTCTGGGACAGAACGCCGACCAGGAAGCCGTCCAAACGCCCGAGC
ATCCTTCGTCGCCTGTCGTCCCGCCGCAGCGTACAACGCACCGACGTGCCGTCGGCGGGCGGCCGCGGAAGCGCC
GAAAAGGCCCCGTCGCCCGGCATAGCGGCGCGCCACAGGGACCTCCACGTCGACTTCGCGCCCCAGCAGGATGCG
GGCCGGGACGGCGGCGGCGTCGAAACGCCGAGGAGGCCGCACACGCCAAATCGCCACGTGGAGTGGGCCGAGGCG
GCGGACTCGGAGAAGCATGCGGACCACGGAGCGCCGGAGTCGCAGCGCCCCACTGCGGCCCAGGATCAGGCGTCC
CTCCCGCACCTGGGCATCAACGTGCCGGTCGTGCAGCTGTCGGAGGACGCGCACGACGTGGACGAGATCAAGTCC
GTCTCGAGCCACGGCCGTCGCGTGTCGTCGCCGAGACCCAATGCCGCCGCCGCCGCCGCCGCCGGCCAGCTGGAC
AGCTTGGCCGTCTCGCCCTACTCGCATCACGCGACCGGGAGCGAGTCCAACATCGATTACCTCAGTAGGGGACCC
AATCTGGACGAGGAGAAGATACCGGCGTCTGCGCTCAGGGCGCCGCCAAAGGTGCAGGCGTACACGCATAATCTG
CGTCACCAGCCGGCGCAGACGTTCTTGCAGCAGCTGCGGCCGTACCACGGCCGGCTCAACCACGACAACTGGTTC
AAGGTGGCGGTCAGGCCCTTCATCCTGTTCGCCTACCCGGCGGTGCTCTGGTCGGCGGCCGTGTACGCCTGCTCG
ATCGGCTGGCTCATCGTCATCTCGGAGACGATGGCCGTCATCTACCGCGACCCGAACGTGTACAACTTCAACGCG
CTGCAGACGGGCCTCGTCTACATCTCGCCCTTCGTGGGCGGGATCCTGGGGACCGGGGTTGCGGGCAAGGTCAGC
GACGTCATCGTGCGGATCATGTCGCGGCGCAACGGCGGGCTCTACGAACCCGAGTTCCGGCTAGTCATGGGGCTA
CCGGTGCTGATCACGACGTGCATGGGGCTCATGGGCTTCGGCTGGTCAGCGCAGGAGCGCGACCACTGGATCGTG
CCGACGCTCTTCTTCGGCGTGCTGTCGTTCGGGTGCTCGCTGGGGTCGACGACGTCGATCACGTTCTGCGTCGAC
AGCTACCGCCAGTACGCGGGCGAGGCGCTGGTGACGCTCAACTTCTCCAAGAACGTGCTGCACGGCCTCGCCTTC
AGCCTGTTCGTGTCGCACTGGATTGCCAAGGATGGGCCCAAGCAGGTCTACGTGTGGCTGGGCATCATCCAGCTG
ATCCTGATGCTGTTCACGGTTCCCCTGTACATCTTCGGCAAGCGCGCGCGCATGTGGACGGTCAGGAAGAACTTT
ATGGAGAAGTTCTGA
Gene >Hirsu2|2994
ATGGAGCCGGGGCAGGACACGGCCATGTCTTCGTCTTCCGAAGACCTCAAGGACTCCCCCGCCCGCTGGAAGATG
CCCCGCCTCTTCCGCGGGCGGCGTCCTGACCCGGACTCGCCAGCCGACCACAAGCCGGGCCACTCGAAATGGAGC
ATGGGTGTCTTGAACGACAGGGAGACGGTCGAAGTCCCCGGTAAGACGCGCCCCTGCTGAAAGCCCCGCCTCCCT
GTGCTGATCCTCGCAGGCTCCGTCTTGCTGCTCGCCGCGGACCACAACGAGCCGCTGGGCCTCCGCAACGTCCAC
GCCAGGACCTCGCACTCGTCTATCCCGGTCGGCTTCCCTGTCGACGCCACACTGAGCCCGAGCAGCACCCGGCCC
TCGTCTCACCCTCAGCACCAGCGCCAGTCCGAGGCCGAGTCCTTCGGGGACAAGAAGCTGACTAGTGACGGCACC
ATCATCCTCGACCCCCAGCCCGAGGACTCGGCCAACGACCCGCTCAACTGGCCCAGCTGGCGCCGCGACACGGCC
CTGCTGTCTCTGGGTTTCTACTGCATGATCGGCGGCGGCATCACGCCCATCATCGCCGCCGGCTTCACCGACGTG
GCCCGCGACTACCATGTCGACGTCGAGACCGTCCCCCTCACCACGGGTCTCTACATGATGGGTCTTGGTTTGGGC
TCGGTCATCGCGTCCCCCACGGCCATTTTGTTCGGCAAGCGTCCCGTCTACCTTGCTAGTGCCATCGTCTTCATC
GGCACCTGCCTGTGGGCGGCATGGTCCCCCAGCTTCTCCTCCCTGCTGGCCGCCAGGGTCTTTCAGGGCGTCGCC
ATCAGCCCGGTCGAGTGCCTCCCCTCCGCCACCATCGCCGAGATCTTCTTCCTCCACGAGCGCGCCTACCGCATC
GGCATCTACACCCTTCTGCTGCTGGGCGGCAAGAACCTGGTCCCCCTGGTCAGCGCCGCCATCATAAGTCGCTTC
GGCTGGCGCTGGGTCTTTTGGTCGGTTCCCCCTCCCTCCCTCCTCGCCCGTCCTGGCCCCGATCGGCTGACGCGT
CTCTCCCTTCCAGGATCGTCGCCATGGTTGTCGGCCTCGGCTTCGTTCTCCTCTTCCTCTTCGTCCCCGAGACCT
TCTGGGACAGAACGCCGACCAGGAAGCCGTCCAAACGCCCGAGCATCCTTCGTCGCCTGTCGTCCCGCCGCAGCG
TACAACGCACCGACGTGCCGTCGGCGGGCGGCCGCGGAAGCGCCGAAAAGGCCCCGTCGCCCGGCATAGCGGCGC
GCCACAGGGACCTCCACGTCGACTTCGCGCCCCAGCAGGATGCGGGCCGGGACGGCGGCGGCGTCGAAACGCCGA
GGAGGCCGCACACGCCAAATCGCCACGTGGAGTGGGCCGAGGCGGCGGACTCGGAGAAGCATGCGGACCACGGAG
CGCCGGAGTCGCAGCGCCCCACTGCGGCCCAGGATCAGGCGTCCCTCCCGCACCTGGGCATCAACGTGCCGGTCG
TGCAGCTGTCGGAGGACGCGCACGACGTGGACGAGATCAAGTCCGTCTCGAGCCACGGCCGTCGCGTGTCGTCGC
CGAGACCCAATGCCGCCGCCGCCGCCGCCGCCGGCCAGCTGGACAGCTTGGCCGTCTCGCCCTACTCGCATCACG
CGACCGGGAGCGAGTCCAACATCGATTACCTCAGTAGGGGACCCAATCTGGACGAGGAGAAGATACCGGCGTCTG
CGCTCAGGGCGCCGCCAAAGGTGCAGGCGTACACGCATAATCTGCGTCACCAGCCGGCGCAGACGTTCTTGCAGC
AGCTGCGGCCGTACCACGGCCGGCTCAACCACGACAACTGGTTCAAGGTGGCGGTCAGGCCCTTCATCCTGTTCG
CCTACCCGGCGGTGCTCTGGTCGGCGGCCGTGTACGCCTGCTCGATCGGCTGGCTCATCGTCATCTCGGAGACGA
TGGCCGTCATCTACCGCGACCCGAACGTGTACAACTTCAACGCGCTGCAGACGGGCCTCGTCTACATCTCGCCCT
TCGTGGGCGGGATCCTGGGGACCGGGGTTGCGGGCAAGGTCAGCGACGTCATCGTGCGGATCATGTCGCGGCGCA
ACGGCGGGCTCTACGAACCCGAGTTCCGGCTAGTCATGGGGCTACCGGTGCTGATCACGACGTGCATGGGGCTCA
TGGGCTTCGGCTGGTCAGCGCAGGAGCGCGACCACTGGATCGTGCCGACGCTCTTCTTCGGCGTGCTGTCGTTCG
GGTGCTCGCTGGGGTCGACGACGTCGATCACGTTCTGCGTCGACAGCTACCGCCAGTACGCGGGCGAGGCGCTGG
TGACGCTCAACTTCTCCAAGAACGTGCTGCACGGCCTCGCCTTCAGCCTGTTCGTGTCGCACTGGATTGCCAAGG
ATGGGCCCAAGCAGGTCTACGTGTGGCTGGGCATCATCCAGCTGATCCTGATGCTGTTCACGGTTCCCCTGTACA
TCTTCGGCAAGCGCGCGCGCATGTGGACGGTCAGGAAGAACTTTATGGAGAAGTTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail