Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2991
Gene name
LocationContig_1755:3429..5041
Strand+
Gene length (bp)1612
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 1.6E-14 266 345

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 57 490 3.0E-115
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 72 448 2.0E-97
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 72 449 3.0E-95
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 49 447 3.0E-94
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 42 427 1.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 57 490 3.0E-115
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 72 448 2.0E-97
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 72 449 3.0E-95
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 49 447 3.0E-94
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 42 427 1.0E-87
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 70 417 1.0E-52
sp|Q6CLN2|GPI7_KLULA GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAS21 PE=3 SV=1 79 476 1.0E-52
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 70 417 2.0E-47
sp|Q09782|GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las21 PE=3 SV=1 128 443 3.0E-47
sp|Q758B8|GPI7_ASHGO GPI ethanolamine phosphate transferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LAS21 PE=3 SV=2 131 417 3.0E-45
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 124 417 6.0E-45
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 70 417 1.0E-44
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 80 446 2.0E-42
sp|P40367|GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS21 PE=1 SV=1 131 415 3.0E-42
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 68 423 8.0E-40
sp|Q6FPB2|GPI7_CANGA GPI ethanolamine phosphate transferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LAS21 PE=3 SV=1 107 417 8.0E-40
sp|Q757X5|MCD4_ASHGO GPI ethanolamine phosphate transferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCD4 PE=3 SV=2 288 444 5.0E-09
sp|Q6CW36|MCD4_KLULA GPI ethanolamine phosphate transferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCD4 PE=3 SV=1 267 498 2.0E-07
sp|P36051|MCD4_YEAST GPI ethanolamine phosphate transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCD4 PE=1 SV=1 288 444 3.0E-07
sp|Q6FJ81|MCD4_CANGA GPI ethanolamine phosphate transferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCD4 PE=3 SV=1 293 445 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2991
MSQRGADDGQDNTSPKSEYRAIAKQWEQAKRAKQTHEAEAGQHERGGDAAEGRRRQLNERRRKGYERRWRWTVAF
WLWLLAMHAGGIWLFTSGFLLTRLVLEDKSQCGLPPVDSPLASRSVEHGCWHPKTFERAVVVIIDALRYDFTVPE
ERSRARHFHNALPFLHESAVASPHNAFLRPFIADPPTTTLQRLKGLTTGTLPTFIDAGSNFAGTAIDEDNLLLQL
RRAGKKIAHLGDDTWWALFPGYFEPNVSRAYDSFNVPDLHTVDNGVIDHIFPLLEPAAGRSWDLLIGHCLGVDHA
GHRYGPDHAEMRAKLQQMDRFVRRLAAAVDDDTLLVVMGDHGMDSKGDHGGESDDEVEAALWMYSKRPVFGRTAP
EHAAPPPTAKVRPVNQIDLVPTLALLLGIAIPYNNLGRPIEEAFAGRDGRDWANLAAASRMAAAGIQRYQQSYFD
ARGIARRDAEPGSPARLWAEADGGALPPRDAYDAYARFQAETLRVCKGLARTTSTSS*
Coding >Hirsu2|2991
ATGTCGCAGCGCGGCGCCGACGACGGCCAAGATAACACGTCTCCCAAGAGCGAGTACCGGGCCATCGCGAAGCAG
TGGGAACAGGCGAAGCGGGCCAAGCAGACTCACGAGGCCGAGGCCGGCCAGCATGAACGGGGCGGGGACGCGGCC
GAGGGCCGGCGGCGGCAGCTCAACGAGCGGCGCCGCAAGGGCTACGAGCGGCGCTGGCGGTGGACCGTCGCCTTC
TGGCTCTGGCTGCTGGCCATGCACGCCGGCGGCATCTGGCTCTTCACCAGCGGCTTCCTGCTGACGCGGCTGGTG
CTGGAGGACAAGTCGCAGTGCGGGCTGCCGCCCGTCGACAGCCCGCTGGCCTCGCGCTCCGTCGAGCACGGCTGC
TGGCACCCCAAGACGTTCGAGCGGGCCGTCGTCGTCATCATCGACGCGCTGCGCTACGACTTCACGGTCCCCGAG
GAGCGGTCGCGCGCGCGCCACTTCCACAACGCGCTGCCCTTCCTGCACGAGTCGGCCGTGGCCTCGCCGCACAAC
GCCTTCCTGCGGCCCTTCATCGCCGACCCGCCGACGACGACGCTGCAGCGGCTCAAGGGCCTGACGACCGGCACG
CTGCCCACCTTCATCGACGCCGGCAGCAACTTCGCCGGCACGGCCATCGACGAGGACAACCTGCTGCTGCAGCTG
CGGCGCGCCGGCAAGAAGATTGCCCACCTGGGCGACGACACCTGGTGGGCCCTGTTCCCGGGCTACTTCGAGCCC
AACGTGTCGCGCGCCTACGACAGCTTCAACGTGCCGGACCTGCACACCGTCGACAACGGCGTCATCGACCACATC
TTCCCCCTGCTCGAGCCCGCCGCCGGGCGCTCGTGGGACCTGCTCATCGGCCACTGCCTCGGCGTCGACCACGCT
GGCCACCGCTACGGGCCCGACCACGCCGAGATGAGGGCCAAGCTGCAGCAGATGGACCGCTTCGTCCGCCGGCTG
GCGGCCGCCGTCGACGACGACACCCTGCTCGTCGTCATGGGCGACCACGGCATGGACAGCAAGGGCGACCACGGC
GGCGAGAGCGACGACGAGGTCGAGGCCGCGCTGTGGATGTACTCGAAGCGGCCCGTCTTCGGCCGCACCGCGCCC
GAGCACGCCGCGCCCCCGCCCACGGCCAAGGTGCGCCCCGTCAACCAGATCGACCTGGTGCCGACCCTGGCGCTG
CTGCTCGGCATCGCCATACCCTACAACAACCTGGGCCGCCCCATCGAGGAGGCCTTTGCCGGGCGCGACGGCCGC
GACTGGGCCAACCTCGCCGCCGCCTCGCGCATGGCCGCCGCCGGCATCCAGCGCTACCAGCAGTCGTACTTTGAC
GCCCGCGGCATCGCCCGGCGGGACGCGGAGCCCGGCTCGCCGGCCCGGCTGTGGGCCGAGGCCGACGGCGGCGCG
CTGCCGCCGCGGGACGCCTACGACGCCTACGCCCGCTTCCAGGCCGAGACGCTGCGGGTGTGCAAGGGCCTAGCC
CGGACGACGAGTACGTCGTCATGA
Transcript >Hirsu2|2991
ATGTCGCAGCGCGGCGCCGACGACGGCCAAGATAACACGTCTCCCAAGAGCGAGTACCGGGCCATCGCGAAGCAG
TGGGAACAGGCGAAGCGGGCCAAGCAGACTCACGAGGCCGAGGCCGGCCAGCATGAACGGGGCGGGGACGCGGCC
GAGGGCCGGCGGCGGCAGCTCAACGAGCGGCGCCGCAAGGGCTACGAGCGGCGCTGGCGGTGGACCGTCGCCTTC
TGGCTCTGGCTGCTGGCCATGCACGCCGGCGGCATCTGGCTCTTCACCAGCGGCTTCCTGCTGACGCGGCTGGTG
CTGGAGGACAAGTCGCAGTGCGGGCTGCCGCCCGTCGACAGCCCGCTGGCCTCGCGCTCCGTCGAGCACGGCTGC
TGGCACCCCAAGACGTTCGAGCGGGCCGTCGTCGTCATCATCGACGCGCTGCGCTACGACTTCACGGTCCCCGAG
GAGCGGTCGCGCGCGCGCCACTTCCACAACGCGCTGCCCTTCCTGCACGAGTCGGCCGTGGCCTCGCCGCACAAC
GCCTTCCTGCGGCCCTTCATCGCCGACCCGCCGACGACGACGCTGCAGCGGCTCAAGGGCCTGACGACCGGCACG
CTGCCCACCTTCATCGACGCCGGCAGCAACTTCGCCGGCACGGCCATCGACGAGGACAACCTGCTGCTGCAGCTG
CGGCGCGCCGGCAAGAAGATTGCCCACCTGGGCGACGACACCTGGTGGGCCCTGTTCCCGGGCTACTTCGAGCCC
AACGTGTCGCGCGCCTACGACAGCTTCAACGTGCCGGACCTGCACACCGTCGACAACGGCGTCATCGACCACATC
TTCCCCCTGCTCGAGCCCGCCGCCGGGCGCTCGTGGGACCTGCTCATCGGCCACTGCCTCGGCGTCGACCACGCT
GGCCACCGCTACGGGCCCGACCACGCCGAGATGAGGGCCAAGCTGCAGCAGATGGACCGCTTCGTCCGCCGGCTG
GCGGCCGCCGTCGACGACGACACCCTGCTCGTCGTCATGGGCGACCACGGCATGGACAGCAAGGGCGACCACGGC
GGCGAGAGCGACGACGAGGTCGAGGCCGCGCTGTGGATGTACTCGAAGCGGCCCGTCTTCGGCCGCACCGCGCCC
GAGCACGCCGCGCCCCCGCCCACGGCCAAGGTGCGCCCCGTCAACCAGATCGACCTGGTGCCGACCCTGGCGCTG
CTGCTCGGCATCGCCATACCCTACAACAACCTGGGCCGCCCCATCGAGGAGGCCTTTGCCGGGCGCGACGGCCGC
GACTGGGCCAACCTCGCCGCCGCCTCGCGCATGGCCGCCGCCGGCATCCAGCGCTACCAGCAGTCGTACTTTGAC
GCCCGCGGCATCGCCCGGCGGGACGCGGAGCCCGGCTCGCCGGCCCGGCTGTGGGCCGAGGCCGACGGCGGCGCG
CTGCCGCCGCGGGACGCCTACGACGCCTACGCCCGCTTCCAGGCCGAGACGCTGCGGGTGTGCAAGGGCCTAGCC
CGGACGACGAGTACGTCGTCATGA
Gene >Hirsu2|2991
ATGTCGCAGCGCGGCGCCGACGACGGCCAAGATAACACGTCTCCCAAGAGCGAGTACCGGGCCATCGCGAAGCAG
TGGGAACAGGCGAAGCGGGCCAAGCAGACTCACGAGGCCGAGGCCGGCCAGCATGAACGGGGCGGGGACGCGGCC
GAGGGCCGGCGGCGGCAGCTCAACGAGCGGCGCCGCAAGGGCTACGAGCGGCGCTGGCGGTGGACCGTCGCCTTC
TGGCTCTGGCTGCTGGCCATGCACGCCGGCGGCATCTGGCTCTTCACCAGCGGCTTCCTGCTGACGCGGCTGGTG
CTGGAGGACAAGTCGCAGTGCGGGCTGCCGCCCGTCGACAGCCCGCTGGCCTCGCGCTCCGTCGAGCACGGCTGC
TGGCACCCCAAGACGTTCGAGCGGGCCGTCGTCGTCATCATCGACGCGCTGCGCTACGACTTCACGGTCCCCGAG
GAGCGGTCGCGCGCGCGCCACTTCCACAACGCGCTGCCCTTCCTGCACGAGTCGGCCGTGGCCTCGCCGCACAAC
GCCTTCCTGCGGCCCTTCATCGCCGACCCGCCGACGACGACGCTGCAGCGGCTCAAGGGCCTGACGACCGGCACG
CTGCCCACCTTCATCGACGCCGGCAGCAACTTCGCCGGCACGGCCATCGACGAGGACAACCTGCTGCTGCAGCTG
CGGCGCGCCGGCAAGAAGATTGCCCACCTGGGCGACGACACCTGGTGGGCCCTGTTCCCGGGCTACTTCGAGCCC
AACGTGTCGCGCGCCTACGACAGCTTCAACGTGCCGGACCTGCACACCGTCGACAACGGCGTCATCGACCACATC
TTCCCCCTGCTCGAGCCCGCCGCCGGGCGCTCGTGGGACCTGCTCATCGGCCACTGCCTCGGCGTCGACCACGCT
GGCCACCGCTACGGGCCCGACCACGCCGAGATGAGGGCCAAGCTGCAGCAGATGGACCGCTTCGTCCGCCGGCTG
GCGGCCGCCGTCGACGACGACACCCTGCTCGTCGTCATGGGCGACCACGGCATGGACAGCAAGGGCGACCACGGC
GGCGAGAGCGACGACGAGGTCGAGGCCGCGCTGTGGATGTACTCGAAGCGGCCCGTCTTCGGCCGCACCGCGCCC
GAGCACGCCGCGCCCCCGCCCACGGCCAAGGTGCGCCCCGTCAACCAGATCGACCTGGTGCCGACCCTGGCGCTG
CTGCTCGGCATCGCCATACCCTACAACAACCTGGGCCGCCCCATCGAGGAGGCCTTTGCCGGGCGCGACGGCCGC
GACTGGGCCAACCTCGCCGCCGCCTCGCGCATGGCCGCCGCCGGCATCCAGCGCTACCAGCAGTCGTACTTTGAC
GCCCGCGGCATCGCCCGGCGGGACGCGGAGCCCGGCTCGCCGGCCCGGCTGTGGGCCGAGGCCGACGGCGGCGCG
CTGCCGCCGCGGGACGCCTACGACGCCTACGCCCGCTTCCAGGCCGAGACGCTGCGGGTGTGCAAGGGCCTGTGG
GCGCGCTTCGACGTGCCGCGCATGGTGGCCGGCGTCGTCGTCACGGCCGTCGGCGTCGTGGTGCTGCTCCTGTAC
GCGTCCAAGAGCCCGGACGACGAGTACGTCGTCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail