Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2984
Gene name
LocationContig_1750:1869..4910
Strand+
Gene length (bp)3041
Transcript length (bp)2637
Coding sequence length (bp)2637
Protein length (aa) 879

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02985 HEAT HEAT repeat 1.3E-03 372 400
PF02985 HEAT HEAT repeat 1.1E-03 414 443
PF13513 HEAT_EZ HEAT-like repeat 5.5E-07 384 438
PF03810 IBN_N Importin-beta N-terminal domain 1.5E-06 24 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 8 867 0.0E+00
sp|Q06142|IMB1_YEAST Importin subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP95 PE=1 SV=1 1 869 0.0E+00
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 5 866 2.0E-177
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 5 866 7.0E-177
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 5 866 6.0E-176
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 8 867 0.0E+00
sp|Q06142|IMB1_YEAST Importin subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP95 PE=1 SV=1 1 869 0.0E+00
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 5 866 2.0E-177
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 5 866 7.0E-177
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 5 866 6.0E-176
sp|P52296|IMB1_RAT Importin subunit beta-1 OS=Rattus norvegicus GN=Kpnb1 PE=1 SV=1 5 866 8.0E-173
sp|O18388|IMB_DROME Importin subunit beta OS=Drosophila melanogaster GN=Fs(2)Ket PE=2 SV=2 9 866 3.0E-169
sp|Q9FJD4|IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana GN=KPNB1 PE=1 SV=1 5 868 1.0E-158
sp|B8ARW2|TNPO1_ORYSI Transportin-1 OS=Oryza sativa subsp. indica GN=OsI_18044 PE=2 SV=1 275 441 1.0E-06
sp|B9FDR3|TNPO1_ORYSJ Transportin-1 OS=Oryza sativa subsp. japonica GN=TRN1 PE=3 SV=2 275 441 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0005515 protein binding Yes
GO:0008536 Ran GTPase binding Yes
GO:0006810 transport No
GO:0051649 establishment of localization in cell No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0015833 peptide transport No
GO:0071705 nitrogen compound transport No
GO:0008150 biological_process No
GO:0017016 Ras GTPase binding No
GO:0005488 binding No
GO:0051641 cellular localization No
GO:0019899 enzyme binding No
GO:0008104 protein localization No
GO:0051020 GTPase binding No
GO:0033036 macromolecule localization No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0015031 protein transport No
GO:0031267 small GTPase binding No
GO:0042886 amide transport No
GO:0051234 establishment of localization No
GO:0071702 organic substance transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2984
MSSSEINQVLANSLSPDANLRNAAEQQLSQAAESNFPLYLATLVQELANEQADGSIRAAAGLALKNALLARDFAR
HQELQAKWLQQTDDDTKNRVKQLTLQTLSSSNTQAGTAAAQVISSIAAIELPRHQWSDLMPFLVKNVSEGADHQK
QASLTTIGYICESQDSELRMALVSHSNAILTAVVQGARKEETNGEVRHAAITALGDSLEFVGNNFKHEGERNYIM
QVVCEATQADDSRIQQGAFGCLNRIMNLYYDNMRYYMEKALFGLTILGMKSDDEDVAKLAVEFWCTVCEEELSIE
DDNAQVEIADQMRPFFNFARVAANEVVPVLLMLLTKQDEDAADDEYNLSRAAYQCLQLYSQAVGASIIAPVLQFV
EANLRSDDWHHRDAAVSAFGAIMEGPDEKVLDPIVKQALPILITMMDDQSLQVRDSTAYALGRVTEACSDAIDPA
QHLPTLIESLFKGLLSSAKMAPSCCWALMNLAERFAVDVSGSGANPITPHFNQAVSSLLDVTARQDADTSVRTAA
YEVLNVFVQNAAAESLSAVASLSEVVLKRLEETVPLQSQVVSVEDKITLEEMQNSLCTVLQAIILRLDKDIAPQG
DRIMQVLLQILSVVGGKSSVPEAVFATISALSTSIEEDFIKYMDAFAPFLYNALGNQEEPSLCSMGIGLVSDITR
SVGERCQPYCDNFMNYLLNNLRSTTLANQFKPAILQCFGDIAGAIGGHFETYLSVVAQVLEQASTVSATPEGTYE
MYDYVISLREGIMDAWGGIIGAMKASGKTQSLQQYVAAIFSLLGQIANDMNRSESLMRACMGVIGDLAEAYPNGE
LVHGFFRQEWLTAMIKETKTNRDFQPRTIETARWAREQVKRQLGGAQTVMAQS*
Coding >Hirsu2|2984
ATGTCGAGCTCAGAGATTAATCAGGTGCTCGCCAACTCGCTGTCGCCGGACGCGAACCTGCGAAACGCCGCCGAG
CAGCAGTTGAGCCAAGCAGCCGAGAGCAACTTCCCGCTCTACCTGGCGACGCTCGTCCAAGAGCTGGCAAATGAA
CAAGCAGACGGCTCCATCCGGGCCGCCGCCGGCCTGGCCCTCAAGAACGCCCTGCTCGCCCGGGACTTCGCCCGC
CACCAAGAACTGCAGGCCAAGTGGCTGCAACAGACCGACGACGACACCAAGAACCGCGTCAAGCAGCTGACGCTG
CAGACGCTGTCGTCGTCCAACACGCAAGCCGGCACCGCCGCCGCCCAGGTCATCTCGTCCATCGCCGCCATCGAG
CTGCCCCGCCACCAGTGGAGCGACCTGATGCCCTTCCTCGTCAAGAACGTCAGCGAGGGCGCCGACCACCAGAAG
CAGGCCTCGCTCACCACCATTGGCTACATCTGCGAGAGCCAGGACTCGGAGCTGCGCATGGCCCTCGTCTCCCAC
TCCAACGCCATCCTCACCGCCGTCGTCCAGGGCGCCCGCAAGGAGGAGACCAACGGCGAGGTCCGCCACGCCGCC
ATCACCGCCCTCGGCGACTCGCTCGAGTTCGTCGGCAACAACTTCAAGCACGAGGGCGAGCGCAACTACATCATG
CAGGTCGTCTGCGAGGCCACCCAGGCCGACGACTCGCGCATCCAGCAGGGCGCCTTCGGCTGCCTCAACCGCATC
ATGAACCTCTACTACGACAACATGCGCTACTACATGGAGAAGGCCCTCTTCGGCCTCACCATCCTCGGCATGAAG
TCGGACGACGAGGACGTGGCCAAGCTCGCCGTCGAGTTCTGGTGCACCGTCTGCGAGGAGGAGCTGTCCATCGAG
GACGACAACGCCCAGGTCGAAATCGCCGACCAGATGCGCCCCTTCTTCAACTTCGCCCGCGTCGCCGCCAACGAG
GTCGTGCCCGTCCTGCTCATGCTCCTGACCAAGCAGGACGAGGACGCCGCCGACGACGAGTACAACCTGTCCCGC
GCCGCCTACCAGTGCCTCCAGCTCTACTCGCAGGCCGTCGGCGCCAGCATCATCGCCCCCGTCCTGCAGTTCGTC
GAGGCCAACCTGCGCTCCGACGACTGGCACCACCGCGACGCCGCCGTCTCCGCCTTTGGCGCCATCATGGAGGGC
CCCGACGAGAAGGTCCTCGACCCCATCGTCAAGCAGGCCCTCCCCATCCTCATCACCATGATGGACGACCAGTCC
CTCCAGGTCCGCGACTCGACCGCCTACGCCCTCGGCCGCGTCACCGAGGCCTGCTCCGACGCCATCGACCCCGCC
CAGCACCTGCCCACCCTGATCGAGTCGCTCTTCAAGGGCCTCCTCAGCAGCGCCAAGATGGCCCCGTCGTGCTGC
TGGGCCCTCATGAACCTCGCCGAGCGCTTCGCCGTCGACGTCAGCGGCTCCGGCGCGAACCCCATCACGCCCCAC
TTCAACCAGGCCGTCAGCTCCCTGCTCGACGTGACGGCCCGCCAGGACGCCGACACGTCGGTCCGCACCGCCGCC
TACGAGGTCCTCAACGTCTTCGTCCAGAACGCGGCCGCCGAGAGCCTGTCGGCCGTCGCCTCGCTGTCCGAGGTG
GTGCTCAAGCGCCTCGAGGAGACGGTCCCGCTGCAGTCGCAGGTCGTCAGCGTCGAGGACAAGATCACGCTCGAG
GAGATGCAGAACAGCCTGTGCACCGTCCTGCAGGCCATCATCCTGCGCCTCGACAAGGACATCGCCCCGCAGGGC
GACCGCATCATGCAGGTCCTGCTGCAGATCCTCAGCGTCGTCGGCGGCAAGTCGAGCGTCCCCGAGGCCGTCTTC
GCCACCATCAGCGCGCTGTCCACGTCGATCGAGGAGGACTTCATCAAGTACATGGACGCCTTCGCCCCCTTCCTC
TACAACGCCCTCGGCAACCAGGAGGAGCCCAGCCTCTGCTCCATGGGCATCGGCCTCGTCAGCGACATCACCAGG
TCCGTCGGCGAGCGCTGCCAGCCCTACTGCGACAACTTTATGAACTACCTGCTCAACAACCTCAGGAGCACCACG
CTCGCCAACCAGTTCAAGCCCGCCATCCTGCAGTGCTTCGGCGACATCGCCGGCGCCATCGGCGGCCACTTCGAG
ACGTACCTCTCCGTCGTGGCCCAGGTCCTCGAGCAGGCGTCGACGGTGTCGGCCACGCCCGAGGGCACGTACGAG
ATGTACGACTATGTCATCTCGCTCCGGGAGGGCATCATGGATGCCTGGGGCGGCATCATCGGCGCCATGAAGGCC
AGCGGCAAGACCCAAAGCCTCCAGCAATACGTGGCGGCCATCTTCAGCCTGCTCGGCCAGATTGCCAACGACATG
AACCGCAGCGAGTCGTTGATGCGCGCGTGCATGGGCGTCATCGGCGACCTGGCCGAGGCTTACCCCAACGGCGAG
CTGGTCCACGGCTTCTTCCGCCAAGAGTGGCTGACGGCCATGATCAAGGAGACCAAGACCAACCGCGACTTCCAA
CCGCGGACCATCGAGACGGCTCGCTGGGCCCGCGAGCAGGTCAAGCGTCAACTGGGCGGCGCGCAGACTGTCATG
GCCCAGTCTTGA
Transcript >Hirsu2|2984
ATGTCGAGCTCAGAGATTAATCAGGTGCTCGCCAACTCGCTGTCGCCGGACGCGAACCTGCGAAACGCCGCCGAG
CAGCAGTTGAGCCAAGCAGCCGAGAGCAACTTCCCGCTCTACCTGGCGACGCTCGTCCAAGAGCTGGCAAATGAA
CAAGCAGACGGCTCCATCCGGGCCGCCGCCGGCCTGGCCCTCAAGAACGCCCTGCTCGCCCGGGACTTCGCCCGC
CACCAAGAACTGCAGGCCAAGTGGCTGCAACAGACCGACGACGACACCAAGAACCGCGTCAAGCAGCTGACGCTG
CAGACGCTGTCGTCGTCCAACACGCAAGCCGGCACCGCCGCCGCCCAGGTCATCTCGTCCATCGCCGCCATCGAG
CTGCCCCGCCACCAGTGGAGCGACCTGATGCCCTTCCTCGTCAAGAACGTCAGCGAGGGCGCCGACCACCAGAAG
CAGGCCTCGCTCACCACCATTGGCTACATCTGCGAGAGCCAGGACTCGGAGCTGCGCATGGCCCTCGTCTCCCAC
TCCAACGCCATCCTCACCGCCGTCGTCCAGGGCGCCCGCAAGGAGGAGACCAACGGCGAGGTCCGCCACGCCGCC
ATCACCGCCCTCGGCGACTCGCTCGAGTTCGTCGGCAACAACTTCAAGCACGAGGGCGAGCGCAACTACATCATG
CAGGTCGTCTGCGAGGCCACCCAGGCCGACGACTCGCGCATCCAGCAGGGCGCCTTCGGCTGCCTCAACCGCATC
ATGAACCTCTACTACGACAACATGCGCTACTACATGGAGAAGGCCCTCTTCGGCCTCACCATCCTCGGCATGAAG
TCGGACGACGAGGACGTGGCCAAGCTCGCCGTCGAGTTCTGGTGCACCGTCTGCGAGGAGGAGCTGTCCATCGAG
GACGACAACGCCCAGGTCGAAATCGCCGACCAGATGCGCCCCTTCTTCAACTTCGCCCGCGTCGCCGCCAACGAG
GTCGTGCCCGTCCTGCTCATGCTCCTGACCAAGCAGGACGAGGACGCCGCCGACGACGAGTACAACCTGTCCCGC
GCCGCCTACCAGTGCCTCCAGCTCTACTCGCAGGCCGTCGGCGCCAGCATCATCGCCCCCGTCCTGCAGTTCGTC
GAGGCCAACCTGCGCTCCGACGACTGGCACCACCGCGACGCCGCCGTCTCCGCCTTTGGCGCCATCATGGAGGGC
CCCGACGAGAAGGTCCTCGACCCCATCGTCAAGCAGGCCCTCCCCATCCTCATCACCATGATGGACGACCAGTCC
CTCCAGGTCCGCGACTCGACCGCCTACGCCCTCGGCCGCGTCACCGAGGCCTGCTCCGACGCCATCGACCCCGCC
CAGCACCTGCCCACCCTGATCGAGTCGCTCTTCAAGGGCCTCCTCAGCAGCGCCAAGATGGCCCCGTCGTGCTGC
TGGGCCCTCATGAACCTCGCCGAGCGCTTCGCCGTCGACGTCAGCGGCTCCGGCGCGAACCCCATCACGCCCCAC
TTCAACCAGGCCGTCAGCTCCCTGCTCGACGTGACGGCCCGCCAGGACGCCGACACGTCGGTCCGCACCGCCGCC
TACGAGGTCCTCAACGTCTTCGTCCAGAACGCGGCCGCCGAGAGCCTGTCGGCCGTCGCCTCGCTGTCCGAGGTG
GTGCTCAAGCGCCTCGAGGAGACGGTCCCGCTGCAGTCGCAGGTCGTCAGCGTCGAGGACAAGATCACGCTCGAG
GAGATGCAGAACAGCCTGTGCACCGTCCTGCAGGCCATCATCCTGCGCCTCGACAAGGACATCGCCCCGCAGGGC
GACCGCATCATGCAGGTCCTGCTGCAGATCCTCAGCGTCGTCGGCGGCAAGTCGAGCGTCCCCGAGGCCGTCTTC
GCCACCATCAGCGCGCTGTCCACGTCGATCGAGGAGGACTTCATCAAGTACATGGACGCCTTCGCCCCCTTCCTC
TACAACGCCCTCGGCAACCAGGAGGAGCCCAGCCTCTGCTCCATGGGCATCGGCCTCGTCAGCGACATCACCAGG
TCCGTCGGCGAGCGCTGCCAGCCCTACTGCGACAACTTTATGAACTACCTGCTCAACAACCTCAGGAGCACCACG
CTCGCCAACCAGTTCAAGCCCGCCATCCTGCAGTGCTTCGGCGACATCGCCGGCGCCATCGGCGGCCACTTCGAG
ACGTACCTCTCCGTCGTGGCCCAGGTCCTCGAGCAGGCGTCGACGGTGTCGGCCACGCCCGAGGGCACGTACGAG
ATGTACGACTATGTCATCTCGCTCCGGGAGGGCATCATGGATGCCTGGGGCGGCATCATCGGCGCCATGAAGGCC
AGCGGCAAGACCCAAAGCCTCCAGCAATACGTGGCGGCCATCTTCAGCCTGCTCGGCCAGATTGCCAACGACATG
AACCGCAGCGAGTCGTTGATGCGCGCGTGCATGGGCGTCATCGGCGACCTGGCCGAGGCTTACCCCAACGGCGAG
CTGGTCCACGGCTTCTTCCGCCAAGAGTGGCTGACGGCCATGATCAAGGAGACCAAGACCAACCGCGACTTCCAA
CCGCGGACCATCGAGACGGCTCGCTGGGCCCGCGAGCAGGTCAAGCGTCAACTGGGCGGCGCGCAGACTGTCATG
GCCCAGTCTTGA
Gene >Hirsu2|2984
ATGTCGAGCTCAGAGATTAATCAGGTGCTCGCCAACTCGCTGTCGCCGGGTGAGTCGTCGTCCCCGCCCTTGTCG
TGCCTCCGACGCCGTCTGCGACGTGCTCTACCCGGTCCTTGTTTCGCTCTGCCGGGAGCCCCGACGCTGACCTGC
CGACGACGGTGACAGACGCGAACCTGCGAAACGCCGCCGAGCAGCAGTTGAGCCAAGCAGCCGAGAGCAACTTCG
TAGGCCGACCCCGATCCTCGTCCCCTGTGTGCTTCGGCACGCTGGCCGCCCTGCTGACCTGGGCCTCGCACACAG
CCGCTCTACCTGGCGACGCTCGTCCAAGAGCTGGCAAATGAACAAGCAGACGGCTCCATCCGGGCCGCCGCCGGC
CTGGCCCTCAAGAACGCCCTGCTCGCCCGGGACTTCGCCCGCCACCAAGAACTGCAGGCCAAGTGGCTGCAACAG
ACCGACGACGACACCAAGAACCGCGTCAAGCAGCTGACGCTGCAGACGCTGTCGTCGTCCAACACGCAAGCCGGC
ACCGCCGCCGCCCAGGTCATCTCGTCCATCGCCGCCATCGAGCTGCCCCGCCACCAGTGGAGCGACCTGATGCCC
TTCCTCGTCAAGAACGTCAGCGAGGGCGCCGACCACCAGAAGCAGGCCTCGCTCACCACCATTGGCTACATCTGC
GAGAGCCAGGACTCGGAGCTGCGCATGGCCCTCGTCTCCCACTCCAACGCCATCCTCACCGCCGTCGTCCAGGGC
GCCCGCAAGGAGGAGACCAACGGCGAGGTCCGCCACGCCGCCATCACCGCCCTCGGCGACTCGCTCGAGTTCGTC
GGCAACAACTTCAAGCACGAGGGCGAGCGCAACTACATCATGCAGGTCGTCTGCGAGGCCACCCAGGCCGACGAC
TCGCGCATCCAGCAGGGCGCCTTCGGCTGCCTCAACCGCATCATGAACCTCTACTACGACAACATGCGCTACTAC
ATGGAGAAGGCCCTCTTCGGCCTCACCATCCTCGGCATGAAGTCGGACGACGAGGACGTGGCCAAGCTCGCCGTC
GAGTTCTGGTGCACCGTCTGCGAGGAGGAGCTGTCCATCGAGGACGACAACGCCCAGGTCGAAATCGCCGACCAG
ATGCGCCCCTTCTTCAACTTCGCCCGCGTCGCCGCCAACGAGGTCGTGCCCGTCCTGCTCATGCTCCTGACCAAG
CAGGACGAGGACGCCGCCGACGACGAGTACAACCTGTCCCGCGCCGCCTACCAGTGCCTCCAGCTCTACTCGCAG
GCCGTCGGCGCCAGCATCATCGCCCCCGTCCTGCAGTTCGTCGAGGCCAACCTGCGCTCCGACGACTGGCACCAC
CGCGACGCCGCCGTCTCCGCCTTTGGCGCCATCATGGAGGGCCCCGACGAGAAGGTCCTCGACCCCATCGTCAAG
CAGGCCCTCCCCATCCTCATCACCATGATGGACGACCAGTCCCTCCAGGTCCGCGACTCGACCGCCTACGCCCTC
GGCCGCGTCACCGAGGCCTGCTCCGACGCCATCGACCCCGCCCAGCACCTGCCCACCCTGATCGAGTCGCTCTTC
AAGGGCCTCCTCAGCAGCGCCAAGATGGCCCCGTCGTGCTGCTGGGCCCTCATGAACCTCGCCGAGCGCTTCGCC
GTCGACGTCAGCGGCTCCGGCGCGAACCCCATCACGCCCCACTTCAACCAGGCCGTCAGCTCCCTGCTCGACGTG
ACGGCCCGCCAGGACGCCGACACGTCGGTCCGCACCGCCGCCTACGAGGTCCTCAACGTCTTCGTCCAGAACGCG
GCCGCCGAGAGCCTGTCGGCCGTCGCCTCGCTGTCCGAGGTGGTGCTCAAGCGCCTCGAGGAGACGGTCCCGCTG
CAGTCGCAGGTCGTCAGCGTCGAGGACAAGATCACGCTCGAGGAGATGCAGAACAGCCTGTGCACCGTCCTGCAG
GCCATCATCCTGCGCCTCGACAAGGACATCGCCCCGCAGGGCGACCGCATCATGCAGGTCCTGCTGCAGATCCTC
AGCGTCGTCGGCGGCAAGTCGAGCGTCCCCGAGGCCGTCTTCGCCACCATCAGCGCGCTGTCCACGTCGATCGAG
GAGGACTTCATCAAGTACATGGACGCCTTCGCCCCCTTCCTCTACAACGCCCTCGGCAACCAGGAGGAGCCCAGC
CTCTGCTCCATGGGCATCGGCCTCGTCAGCGACATCACCAGGTCCGTCGGCGAGCGCTGCCAGCCCTACTGCGAC
AACTTTATGAACTACCTGCTCAACAACCTCAGGGTTCGTATTCTCCCCCCCCCCTTCCACCCCTCCCACACCCGA
CCGCCCCGTCGCCGCGGGGGCGCAGGCTGACCGGCCGCCGCAGAGCACCACGCTCGCCAACCAGTTCAAGCCCGC
CATCCTGCAGTGCTTCGGCGACATCGCCGGCGCCATCGGCGGCCACTTCGAGACGTACCTCTCCGTCGTGGCCCA
GGTCCTCGAGCAGGCGTCGACGGTGTCGGCCACGCCCGAGGGCACGTACGAGATGTACGACTATGTCATCTCGCT
CCGGGAGGGCATCATGGATGCCTGGGGCGGCATCATCGGCGCCATGAAGGCCAGCGGCAAGAGTGAGTGCATGCC
CAAATGCGTCCCGATCTCCGTCCGCGCTCCCGCGTCTGACGTGCGCCACAGCCCAAAGCCTCCAGCAATACGTGG
CGGCCATCTTCAGCCTGCTCGGCCAGATTGCCAACGACATGAACCGCAGCGAGTCGTTGATGCGCGCGTGCATGG
GCGTCATCGGGTGAGCAGCCGCACCCCGGGATGTGGAGATTTGACACCGGACACGGAGGCTAACGTCGTCCAGCG
ACCTGGCCGAGGCTTACCCCAACGGCGAGCTGGTCCACGGCTTCTTCCGCCAAGAGTGGCTGACGGCCATGATCA
AGGAGACCAAGACCAACCGCGACTTCCAACCGCGGACCATCGAGACGGCTCGCTGGGCCCGCGAGCAGGTCAAGC
GTCAACTGGGCGGCGCGCAGACTGTCATGGCCCAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail