Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2981
Gene name
LocationContig_175:25503..26303
Strand-
Gene length (bp)800
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3416 0.8881 0.3206 0.0147 0.0603 0.0085 0.0279 0.0257 0.0148 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1351
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03813
Ophiocordyceps camponoti-rufipedis Ophun1|5825
Ophiocordyceps subramaniannii Hirsu2|10756
Ophiocordyceps subramaniannii Hirsu2|2981 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3370
Ophiocordyceps subramaniannii Hirsu2|3900
Ophiocordyceps subramaniannii Hirsu2|862

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2981
MKYRGPREAMRREQECHATDRTTGPPKLHVSSGESSDEEPAPKKAKLDGAGLGDATQQARLEVDVRNILIPSDAQ
QRLEEGTFGEADCSLVLAQIALLYPMLLHHDSPRKRSEPSGSCNRLDAIIPQREGRYPKLGVPGGTRSECAPCSN
IDRLEIGLRLSSDATSGTYDTILAVLAGRKPHTLLAEGPKAGFSQWKEVKLKEVFGSKKVAVRAVNRVGLIDLAY
GGYFERDEWKVEGKASSPPR*
Coding >Hirsu2|2981
ATGAAGTACCGGGGTCCTCGAGAGGCCATGAGGAGGGAGCAAGAGTGCCACGCGACAGATCGGACCACTGGCCCG
CCCAAACTACATGTATCGTCAGGCGAGTCCAGCGACGAGGAGCCAGCGCCCAAGAAAGCAAAGCTGGACGGCGCA
GGGCTCGGTGATGCAACGCAACAAGCCCGGCTGGAGGTCGATGTGCGCAACATCCTCATCCCGTCGGACGCGCAG
CAGCGCCTTGAAGAAGGCACCTTTGGAGAGGCCGACTGCAGCCTCGTGCTGGCCCAGATAGCCTTGCTATACCCG
ATGCTCCTCCACCACGACTCACCCCGGAAGCGATCCGAGCCGTCCGGGTCCTGCAACCGGCTCGATGCCATCATC
CCGCAACGGGAGGGCAGGTACCCCAAGTTGGGCGTCCCGGGCGGCACGCGCAGCGAATGCGCACCCTGCAGTAAC
ATCGACCGGCTGGAGATTGGACTCCGGCTGTCCTCCGACGCGACCTCTGGAACGTACGATACCATCCTGGCTGTC
CTCGCCGGGAGGAAACCACACACCTTGCTGGCAGAGGGTCCCAAAGCGGGCTTCAGCCAGTGGAAGGAGGTCAAG
CTCAAGGAAGTTTTTGGTTCGAAAAAGGTTGCCGTTCGTGCCGTCAACCGCGTGGGCCTCATTGATCTTGCCTAC
GGCGGCTACTTCGAGAGGGATGAGTGGAAAGTTGAAGGTAAAGCTTCCTCTCCCCCGAGATGA
Transcript >Hirsu2|2981
ATGAAGTACCGGGGTCCTCGAGAGGCCATGAGGAGGGAGCAAGAGTGCCACGCGACAGATCGGACCACTGGCCCG
CCCAAACTACATGTATCGTCAGGCGAGTCCAGCGACGAGGAGCCAGCGCCCAAGAAAGCAAAGCTGGACGGCGCA
GGGCTCGGTGATGCAACGCAACAAGCCCGGCTGGAGGTCGATGTGCGCAACATCCTCATCCCGTCGGACGCGCAG
CAGCGCCTTGAAGAAGGCACCTTTGGAGAGGCCGACTGCAGCCTCGTGCTGGCCCAGATAGCCTTGCTATACCCG
ATGCTCCTCCACCACGACTCACCCCGGAAGCGATCCGAGCCGTCCGGGTCCTGCAACCGGCTCGATGCCATCATC
CCGCAACGGGAGGGCAGGTACCCCAAGTTGGGCGTCCCGGGCGGCACGCGCAGCGAATGCGCACCCTGCAGTAAC
ATCGACCGGCTGGAGATTGGACTCCGGCTGTCCTCCGACGCGACCTCTGGAACGTACGATACCATCCTGGCTGTC
CTCGCCGGGAGGAAACCACACACCTTGCTGGCAGAGGGTCCCAAAGCGGGCTTCAGCCAGTGGAAGGAGGTCAAG
CTCAAGGAAGTTTTTGGTTCGAAAAAGGTTGCCGTTCGTGCCGTCAACCGCGTGGGCCTCATTGATCTTGCCTAC
GGCGGCTACTTCGAGAGGGATGAGTGGAAAGTTGAAGGTAAAGCTTCCTCTCCCCCGAGATGA
Gene >Hirsu2|2981
ATGAAGTACCGGGGTCCTCGAGAGGCCATGAGGAGGGAGCAAGAGGTAGAAGCTCATTCACGTCCGAGGTGGATA
AGTGCCGGCCGGGGCCGTCTGGCTTGGGGCAGTGCCACGCGACAGATCGGACCACTGGCCCGCCCAAACTACATG
TATCGTCAGGCGAGTCCAGCGACGAGGAGCCAGCGCCCAAGAAAGCAAAGCTGGACGGCGCAGGGCTCGGTGATG
CAACGCAACAAGCCCGGCTGGAGGTCGATGTGCGCAACATCCTCATCCCGTCGGACGCGCAGCAGCGCCTTGAAG
AAGGCACCTTTGGAGAGGCCGACTGCAGCCTCGTGCTGGCCCAGATAGCCTTGCTATACCCGATGCTCCTCCACC
ACGACTCACCCCGGAAGCGATCCGAGCCGTCCGGGTCCTGCAACCGGCTCGATGCCATCATCCCGCAACGGGAGG
GCAGGTACCCCAAGTTGGGCGTCCCGGGCGGCACGCGCAGCGAATGCGCACCCTGCAGTAACATCGACCGGCTGG
AGATTGGACTCCGGCTGTCCTCCGACGCGACCTCTGGAACGTACGATACCATCCTGGCTGTCCTCGCCGGGAGGA
AACCACACACCTTGCTGGCAGAGGGTCCCAAAGCGGGCTTCAGCCAGTGGAAGGAGGTCAAGCTCAAGGAAGTTT
TTGGTTCGAAAAAGGTTGCCGTTCGTGCCGTCAACCGCGTGGGCCTCATTGATCTTGCCTACGGCGGCTACTTCG
AGAGGGATGAGTGGAAAGTTGAAGGTAAAGCTTCCTCTCCCCCGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail