Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|298
Gene name
LocationContig_1057:145..1017
Strand+
Gene length (bp)872
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 3.1E-14 127 259

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 3 261 2.0E-47
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 1 258 8.0E-41
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 1 262 2.0E-33
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 3 257 1.0E-32
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 3 257 4.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 3 261 2.0E-47
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 1 258 8.0E-41
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 1 262 2.0E-33
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 3 257 1.0E-32
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 3 257 4.0E-31
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 3 257 4.0E-31
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 3 257 6.0E-31
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 3 259 1.0E-29
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 3 256 9.0E-29
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 3 257 1.0E-28
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 1 257 6.0E-26
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 3 257 3.0E-24
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 1 257 1.0E-23
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 1 257 1.0E-23
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 3 261 8.0E-22
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 80 257 2.0E-21
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 76 257 3.0E-14
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 3 257 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 41 63 22
3 78 100 22
4 120 139 19
5 154 176 22
6 189 211 22
7 226 243 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|298
MAIVQSRMMDSILSSILLILGSSFVLAGLNAPVVGINADVAGILTSLMIISCAALIMPSALHISDPGCGNAGSDP
SDDVLALSRFASLVLLIFYLLYLYFQSVTHADLLIDDSQEADHELHAVSNCVVLVLSALGVATCSDRQVHSIDGF
VKALGLSRSFVGLIIVPIVGNLGCFVGTVEWSRTNRIQLAISVIVSSTLQISLFVTPLLVVVGWVIDQKMSLQFD
TFQTTVLTISTLVVNCLVRDGETNYFEGVLLVATCVCPCALA*
Coding >Hirsu2|298
ATGGCCATCGTCCAGTCTAGAATGATGGACAGCATCCTATCGTCTATACTGCTGATACTCGGCTCCTCCTTCGTC
CTGGCCGGCCTGAACGCGCCAGTCGTCGGCATCAATGCCGACGTGGCTGGCATCCTGACGTCGCTCATGATCATC
TCGTGTGCCGCCCTCATCATGCCGTCGGCGCTGCACATCTCGGACCCGGGCTGCGGCAACGCCGGCAGCGATCCC
AGCGACGATGTCCTCGCCCTTTCGCGCTTCGCCTCCCTGGTCCTGCTCATCTTCTATCTCCTGTATCTCTACTTC
CAGTCCGTGACGCACGCCGACCTCTTAATCGACGACAGCCAAGAGGCCGACCACGAGCTGCATGCGGTGTCCAAC
TGCGTCGTCCTCGTCCTTTCCGCGCTCGGCGTCGCCACCTGCTCAGATCGCCAGGTCCACAGCATCGACGGCTTC
GTCAAGGCGCTGGGCCTAAGCCGTAGCTTTGTCGGGCTCATCATCGTGCCCATCGTCGGCAACCTGGGCTGTTTT
GTCGGCACCGTCGAGTGGTCCAGGACCAACCGCATACAGCTGGCCATATCCGTCATCGTGAGCAGCACGCTGCAG
ATCTCGCTCTTCGTCACGCCCCTGCTCGTCGTCGTCGGCTGGGTCATCGACCAGAAGATGTCGCTGCAGTTCGAC
ACGTTCCAGACGACTGTCCTGACCATATCCACTCTCGTCGTCAACTGTCTGGTGCGAGATGGAGAAACGAACTAC
TTCGAGGGCGTTCTCCTGGTCGCCACGTGCGTGTGTCCCTGCGCTCTTGCATAG
Transcript >Hirsu2|298
ATGGCCATCGTCCAGTCTAGAATGATGGACAGCATCCTATCGTCTATACTGCTGATACTCGGCTCCTCCTTCGTC
CTGGCCGGCCTGAACGCGCCAGTCGTCGGCATCAATGCCGACGTGGCTGGCATCCTGACGTCGCTCATGATCATC
TCGTGTGCCGCCCTCATCATGCCGTCGGCGCTGCACATCTCGGACCCGGGCTGCGGCAACGCCGGCAGCGATCCC
AGCGACGATGTCCTCGCCCTTTCGCGCTTCGCCTCCCTGGTCCTGCTCATCTTCTATCTCCTGTATCTCTACTTC
CAGTCCGTGACGCACGCCGACCTCTTAATCGACGACAGCCAAGAGGCCGACCACGAGCTGCATGCGGTGTCCAAC
TGCGTCGTCCTCGTCCTTTCCGCGCTCGGCGTCGCCACCTGCTCAGATCGCCAGGTCCACAGCATCGACGGCTTC
GTCAAGGCGCTGGGCCTAAGCCGTAGCTTTGTCGGGCTCATCATCGTGCCCATCGTCGGCAACCTGGGCTGTTTT
GTCGGCACCGTCGAGTGGTCCAGGACCAACCGCATACAGCTGGCCATATCCGTCATCGTGAGCAGCACGCTGCAG
ATCTCGCTCTTCGTCACGCCCCTGCTCGTCGTCGTCGGCTGGGTCATCGACCAGAAGATGTCGCTGCAGTTCGAC
ACGTTCCAGACGACTGTCCTGACCATATCCACTCTCGTCGTCAACTGTCTGGTGCGAGATGGAGAAACGAACTAC
TTCGAGGGCGTTCTCCTGGTCGCCACGTGCGTGTGTCCCTGCGCTCTTGCATAG
Gene >Hirsu2|298
ATGGCCATCGTCCAGTCTAGAATGATGGACAGCATCCTATCGTCTATACTGCTGGTGCGACGGCGGCTCGGCCGG
GCGAGAGGCCCGCGGAATTTGTCTGCTGACCACCGTGCCCTCGTCAGATACTCGGCTCCTCCTTCGTCCTGGCCG
GCCTGAACGCGCCAGTCGTCGGCATCAATGCCGACGTGGCTGGCATCCTGACGTCGCTCATGATCATCTCGTGTG
CCGCCCTCATCATGCCGTCGGCGCTGCACATCTCGGACCCGGGCTGCGGCAACGCCGGCAGCGATCCCAGCGACG
ATGTCCTCGCCCTTTCGCGCTTCGCCTCCCTGGTCCTGCTCATCTTCTATCTCCTGTATCTCTACTTCCAGTCCG
TGACGCACGCCGACCTCTTAATCGACGACAGCCAAGAGGCCGACCACGAGCTGCATGCGGTGTCCAACTGCGTCG
TCCTCGTCCTTTCCGCGCTCGGCGTCGCCACCTGCTCAGATCGCCAGGTCCACAGCATCGACGGCTTCGTCAAGG
CGCTGGGCCTAAGCCGTAGCTTTGTCGGGCTCATCATCGTGCCCATCGTCGGCAACCTGGGCTGTTTTGTCGGCA
CCGTCGAGTGGTCCAGGACCAACCGCATACAGCTGGCCATATCCGTCATCGTGAGCAGCACGCTGCAGATCTCGC
TCTTCGTCACGCCCCTGCTCGTCGTCGTCGGCTGGGTCATCGACCAGAAGATGTCGCTGCAGTTCGACACGTTCC
AGACGACTGTCCTGACCATATCCACTCTCGTCGTCAACTGTCTGGTGCGAGATGGAGAAACGAACTACTTCGAGG
GCGTTCTCCTGGTCGCCACGTGCGTGTGTCCCTGCGCTCTTGCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail