Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2979
Gene name
LocationContig_175:18207..19482
Strand+
Gene length (bp)1275
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.3001 0.2622 0.9402 0.2003 0.1597 0.0823 0.102 0.0256 0.087 0.0793

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6072
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|131
Ophiocordyceps kimflemingae Ophio5|5679
Ophiocordyceps subramaniannii Hirsu2|2554
Ophiocordyceps subramaniannii Hirsu2|2979 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2979
METNVTFSGKIKVKNFRLQECWFDMAVHAGLDLAFKLQAAEHFEQSMNKSTKPLTLPLIAVPGIVTVGPAVQFGV
GVDIKATAAVSAEAKMKLNFDDAKWHLDLVNSSRSVSPGFKPTYEASVKIKEKTPVQVNPYADLRFMLNAKILSL
KDLNGGIRVAPRIANTFTTNTDRELTFPGNRTTQDEGQKSQNPDPVPLETDRPQSDRSQNDTPQSPSPTEGSRSG
NREPTQPKTNKGSRPVPPKGDRPQSPSPTESSRSGNQKPAPPKINKGSKPTPPKSDRPKISRPASSNRPGNPKTA
QPKGKKPNPIPPKPQNPRQSQNGRSKNSKPVQPNNRKGGAKAGKRQKRDSVRALISRAGETEEPANEKQDNGAGQ
PESASNCTDGLWLKSEMQIGIYAFVASNELELFQKNSTITDSCYAWPKN*
Coding >Hirsu2|2979
ATGGAAACCAACGTGACTTTCTCCGGGAAGATCAAGGTCAAGAACTTCCGTCTGCAGGAATGTTGGTTCGATATG
GCCGTCCACGCAGGTCTAGACCTGGCATTCAAGCTTCAAGCCGCAGAGCACTTCGAGCAAAGCATGAACAAGTCT
ACGAAGCCCTTGACCCTCCCGCTTATTGCCGTCCCGGGTATTGTGACGGTCGGCCCGGCCGTCCAATTTGGCGTC
GGAGTGGACATCAAAGCCACAGCCGCAGTGTCAGCCGAGGCCAAGATGAAACTCAACTTCGATGACGCCAAATGG
CACCTCGACCTTGTGAACAGTTCCCGATCTGTCTCTCCCGGTTTCAAGCCGACGTACGAAGCAAGTGTAAAGATC
AAAGAAAAGACCCCCGTACAGGTCAACCCTTATGCAGACCTCAGGTTTATGCTAAACGCAAAGATTCTGTCTCTG
AAAGACCTGAACGGCGGAATCAGAGTCGCGCCCAGGATCGCCAACACATTCACTACCAACACCGACCGAGAGCTT
ACGTTTCCGGGGAATCGAACTACTCAAGATGAAGGGCAGAAGAGCCAGAACCCAGACCCAGTACCGCTCGAGACC
GATAGGCCTCAAAGCGATAGGTCACAGAACGATACGCCACAGAGCCCCAGTCCAACTGAGGGCAGCCGGTCAGGA
AATCGTGAACCGACCCAGCCAAAGACCAACAAAGGATCGAGGCCTGTCCCACCCAAGGGCGATAGGCCACAGAGC
CCCAGCCCGACTGAGAGCAGCCGTTCAGGAAATCAAAAGCCGGCCCCGCCAAAGATCAACAAGGGATCAAAGCCT
ACCCCACCCAAGAGCGACAGGCCAAAGATTTCCAGACCAGCTAGTAGCAACCGGCCAGGGAACCCAAAAACAGCC
CAACCGAAGGGCAAGAAACCAAACCCCATCCCACCCAAGCCACAGAACCCGAGGCAAAGTCAGAACGGCCGATCG
AAGAACAGCAAGCCGGTACAGCCAAACAACAGGAAAGGAGGGGCAAAGGCTGGAAAGCGCCAGAAGCGGGATTCG
GTCAGGGCCTTGATCAGTCGAGCCGGCGAGACCGAGGAGCCGGCAAATGAAAAGCAAGACAACGGGGCTGGACAG
CCCGAGTCCGCGTCCAACTGCACCGATGGCTTATGGCTCAAGAGCGAAATGCAGATTGGTATCTATGCGTTTGTG
GCCTCGAATGAGCTGGAATTGTTCCAGAAAAACTCGACGATAACGGACAGCTGTTATGCCTGGCCGAAGAACTAA
Transcript >Hirsu2|2979
ATGGAAACCAACGTGACTTTCTCCGGGAAGATCAAGGTCAAGAACTTCCGTCTGCAGGAATGTTGGTTCGATATG
GCCGTCCACGCAGGTCTAGACCTGGCATTCAAGCTTCAAGCCGCAGAGCACTTCGAGCAAAGCATGAACAAGTCT
ACGAAGCCCTTGACCCTCCCGCTTATTGCCGTCCCGGGTATTGTGACGGTCGGCCCGGCCGTCCAATTTGGCGTC
GGAGTGGACATCAAAGCCACAGCCGCAGTGTCAGCCGAGGCCAAGATGAAACTCAACTTCGATGACGCCAAATGG
CACCTCGACCTTGTGAACAGTTCCCGATCTGTCTCTCCCGGTTTCAAGCCGACGTACGAAGCAAGTGTAAAGATC
AAAGAAAAGACCCCCGTACAGGTCAACCCTTATGCAGACCTCAGGTTTATGCTAAACGCAAAGATTCTGTCTCTG
AAAGACCTGAACGGCGGAATCAGAGTCGCGCCCAGGATCGCCAACACATTCACTACCAACACCGACCGAGAGCTT
ACGTTTCCGGGGAATCGAACTACTCAAGATGAAGGGCAGAAGAGCCAGAACCCAGACCCAGTACCGCTCGAGACC
GATAGGCCTCAAAGCGATAGGTCACAGAACGATACGCCACAGAGCCCCAGTCCAACTGAGGGCAGCCGGTCAGGA
AATCGTGAACCGACCCAGCCAAAGACCAACAAAGGATCGAGGCCTGTCCCACCCAAGGGCGATAGGCCACAGAGC
CCCAGCCCGACTGAGAGCAGCCGTTCAGGAAATCAAAAGCCGGCCCCGCCAAAGATCAACAAGGGATCAAAGCCT
ACCCCACCCAAGAGCGACAGGCCAAAGATTTCCAGACCAGCTAGTAGCAACCGGCCAGGGAACCCAAAAACAGCC
CAACCGAAGGGCAAGAAACCAAACCCCATCCCACCCAAGCCACAGAACCCGAGGCAAAGTCAGAACGGCCGATCG
AAGAACAGCAAGCCGGTACAGCCAAACAACAGGAAAGGAGGGGCAAAGGCTGGAAAGCGCCAGAAGCGGGATTCG
GTCAGGGCCTTGATCAGTCGAGCCGGCGAGACCGAGGAGCCGGCAAATGAAAAGCAAGACAACGGGGCTGGACAG
CCCGAGTCCGCGTCCAACTGCACCGATGGCTTATGGCTCAAGAGCGAAATGCAGATTGGTATCTATGCGTTTGTG
GCCTCGAATGAGCTGGAATTGTTCCAGAAAAACTCGACGATAACGGACAGCTGTTATGCCTGGCCGAAGAACTAA
Gene >Hirsu2|2979
ATGGAAACCAACGTGACTTTCTCCGGGAAGATCAAGGTCAAGAACTTCCGTCTGCAGGAATGTTGGTTCGATATG
GCCGTCCACGCAGGTCTAGACCTGGCATTCAAGCTTCAAGCCGCAGAGCACTTCGAGCAAAGCATGAACAAGTCT
ACGAAGCCCTTGACCCTCCCGCTTATTGCCGTCCCGGGTATTGTGACGGTCGGCCCGGCCGTCCAATTTGGCGTC
GGAGTGGACATCAAAGCCACAGCCGCAGTGTCAGCCGAGGCCAAGATGAAACTCAACTTCGATGACGCCAAATGG
CACCTCGACCTTGTGAACAGTTCCCGATCTGTCTCTCCCGGTTTCAAGCCGACGTACGAAGCAAGTGTAAAGATC
AAAGAAAAGACCCCCGTACAGGTCAACCCTTATGCAGACCTCAGGTTTATGCTAAACGCAAAGATTCTGTCTCTG
AAAGACCTGAACGGCGGAATCAGAGTCGCGCCCAGGATCGCCAACACATTCACTACCAACACCGACCGAGAGCTT
ACGTTTCCGGGGAATCGAACTACTCAAGATGAAGGGCAGAAGAGCCAGAACCCAGACCCAGTACCGCTCGAGACC
GATAGGCCTCAAAGCGATAGGTCACAGAACGATACGCCACAGAGCCCCAGTCCAACTGAGGGCAGCCGGTCAGGA
AATCGTGAACCGACCCAGCCAAAGACCAACAAAGGATCGAGGCCTGTCCCACCCAAGGGCGATAGGCCACAGAGC
CCCAGCCCGACTGAGAGCAGCCGTTCAGGAAATCAAAAGCCGGCCCCGCCAAAGATCAACAAGGGATCAAAGCCT
ACCCCACCCAAGAGCGACAGGCCAAAGATTTCCAGACCAGCTAGTAGCAACCGGCCAGGGAACCCAAAAACAGCC
CAACCGAAGGGCAAGAAACCAAACCCCATCCCACCCAAGCCACAGAACCCGAGGCAAAGTCAGAACGGCCGATCG
AAGAACAGCAAGCCGGTACAGCCAAACAACAGGAAAGGAGGGGCAAAGGCTGGAAAGCGCCAGAAGCGGGATTCG
GTCAGGGCCTTGATCAGTCGAGCCGGCGAGACCGAGGAGCCGGCAAATGAAAAGCAAGACAACGGGGCTGGACAG
CCCGAGTCCGCGTCCAACTGCACCGATGGCTTATGGCTCAAGAGCGAAATGCAGATTGGTATCTATGCGTTTGTG
GCCTCGAATGAGCTGGAATTGTTCCAGAAAAACTCGACGATAACGGACAGCTGTTATGCCTGGCCGAAGAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail