Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2978
Gene name
LocationContig_175:14743..15607
Strand+
Gene length (bp)864
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 7.4E-08 90 231
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 5.9E-06 60 232

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 103 237 2.0E-06
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 48 237 5.0E-06

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008237 metallopeptidase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2978
MKFAPIVVVLVWTAAAHTPSRNITALHDLLANVRSAESAGLDSDHGDSHQKRWQLKQSGGVCTTKEQQAIDDLYK
KAAMMATNAAQALRNNDQNAQELMRCIFPNADDVFRQDLAGAFDNITQEANYGNSSDFVTVTCEDCGQETYDAHT
EWNKPGEARSANITFCHHAFVEYRGIWSSCKDQIRDLPTVLLHEMTHAAAGKKDFGVYNVPNLLKPNRKRNHADS
VTWFAQALHLGCSIQDLGFDSQCRFDTNFQMWKEKVLLLRYLKKIPVDQRAPTLVRTQRFTS*
Coding >Hirsu2|2978
ATGAAGTTTGCGCCCATTGTTGTCGTCTTGGTTTGGACGGCCGCCGCCCACACTCCGTCCCGGAACATTACAGCG
CTGCACGACCTTCTCGCCAATGTCAGGTCCGCCGAATCCGCCGGCCTGGATTCGGACCATGGGGACTCGCATCAG
AAACGTTGGCAGCTCAAGCAATCGGGCGGCGTCTGCACCACTAAAGAGCAACAGGCTATCGATGACTTGTATAAA
AAGGCCGCCATGATGGCCACCAATGCCGCGCAGGCTCTCCGCAACAATGACCAGAACGCCCAGGAATTGATGCGA
TGCATTTTTCCCAACGCAGACGACGTGTTCCGTCAAGATTTAGCGGGAGCCTTCGACAATATCACCCAAGAGGCG
AATTACGGCAATAGCAGCGATTTCGTAACAGTCACTTGTGAGGACTGTGGACAAGAAACCTACGACGCCCACACC
GAGTGGAACAAACCTGGCGAGGCCAGATCTGCTAACATCACGTTTTGCCATCATGCTTTTGTGGAGTATCGGGGT
ATTTGGTCGAGCTGCAAAGATCAGATTAGGGACCTTCCGACCGTCCTTCTTCACGAGATGACTCACGCCGCCGCC
GGCAAGAAGGACTTCGGGGTATACAACGTTCCGAATTTGCTTAAGCCAAATCGAAAACGCAATCATGCCGACTCA
GTCACTTGGTTTGCTCAGGCCCTTCATCTGGGATGCAGTATCCAAGACCTTGGATTTGACAGCCAATGTCGATTC
GACACAAATTTTCAAATGTGGAAGGAGAAAGTACTACTCCTACGGTACCTCAAGAAAATACCGGTGGATCAGCGA
GCGCCTACTTTGGTACGTACTCAACGATTCACATCATGA
Transcript >Hirsu2|2978
ATGAAGTTTGCGCCCATTGTTGTCGTCTTGGTTTGGACGGCCGCCGCCCACACTCCGTCCCGGAACATTACAGCG
CTGCACGACCTTCTCGCCAATGTCAGGTCCGCCGAATCCGCCGGCCTGGATTCGGACCATGGGGACTCGCATCAG
AAACGTTGGCAGCTCAAGCAATCGGGCGGCGTCTGCACCACTAAAGAGCAACAGGCTATCGATGACTTGTATAAA
AAGGCCGCCATGATGGCCACCAATGCCGCGCAGGCTCTCCGCAACAATGACCAGAACGCCCAGGAATTGATGCGA
TGCATTTTTCCCAACGCAGACGACGTGTTCCGTCAAGATTTAGCGGGAGCCTTCGACAATATCACCCAAGAGGCG
AATTACGGCAATAGCAGCGATTTCGTAACAGTCACTTGTGAGGACTGTGGACAAGAAACCTACGACGCCCACACC
GAGTGGAACAAACCTGGCGAGGCCAGATCTGCTAACATCACGTTTTGCCATCATGCTTTTGTGGAGTATCGGGGT
ATTTGGTCGAGCTGCAAAGATCAGATTAGGGACCTTCCGACCGTCCTTCTTCACGAGATGACTCACGCCGCCGCC
GGCAAGAAGGACTTCGGGGTATACAACGTTCCGAATTTGCTTAAGCCAAATCGAAAACGCAATCATGCCGACTCA
GTCACTTGGTTTGCTCAGGCCCTTCATCTGGGATGCAGTATCCAAGACCTTGGATTTGACAGCCAATGTCGATTC
GACACAAATTTTCAAATGTGGAAGGAGAAAGTACTACTCCTACGGTACCTCAAGAAAATACCGGTGGATCAGCGA
GCGCCTACTTTGGTACGTACTCAACGATTCACATCATGA
Gene >Hirsu2|2978
ATGAAGTTTGCGCCCATTGTTGTCGTCTTGGTTTGGACGGCCGCCGCCCACACTCCGTCCCGGAACATTACAGCG
CTGCACGACCTTCTCGCCAATGTCAGGTCCGCCGAATCCGCCGGCCTGGATTCGGACCATGGGGACTCGCATCAG
AAACGTTGGCAGCTCAAGCAATCGGGCGGCGTCTGCACCACTAAAGAGCAACAGGCTATCGATGACTTGTATAAA
AAGGCCGCCATGATGGCCACCAATGCCGCGCAGGCTCTCCGCAACAATGACCAGAACGCCCAGGAATTGATGCGA
TGCATTTTTCCCAACGCAGACGACGTGTTCCGTCAAGATTTAGCGGGAGCCTTCGACAATATCACCCAAGAGGCG
AATTACGGCAATAGCAGCGATTTCGTAACAGTCACTTGTGAGGACTGTGGACAAGAAACCTACGACGCCCACACC
GAGTGGAACAAACCTGGCGAGGCCAGATCTGCTAACATCACGTTTTGCCATCATGCTTTTGTGGAGTATCGGGGT
ATTTGGTCGAGCTGCAAAGATCAGATTAGGGACCTTCCGACCGTCCTTCTTCACGAGATGACTCACGCCGCCGCC
GGCAAGAAGGACTTCGGGGTATACAACGTTCCGAATTTGCTTAAGCCAAATCGAAAACGCAATCATGCCGACTCA
GTCACTTGGTTTGCTCAGGCCCTTCATCTGGGATGCAGTATCCAAGACCTTGGATTTGACAGCCAATGTCGATTC
GACACAAATTTTCAAATGTGGAAGGAGAAAGTACTACTCCTACGGTACCTCAAGAAAATACCGGTGGATCAGCGA
GCGCCTACTTTGGTACGTACTCAACGATTCACATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail