Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2977
Gene name
LocationContig_175:10150..11989
Strand+
Gene length (bp)1839
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.7E-10 1 78
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.2E-09 136 214
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.9E-13 296 392
PF13637 Ank_4 Ankyrin repeats (many copies) 9.5E-06 20 62
PF13637 Ank_4 Ankyrin repeats (many copies) 4.9E-05 155 206
PF13637 Ank_4 Ankyrin repeats (many copies) 4.0E-06 293 347
PF13637 Ank_4 Ankyrin repeats (many copies) 1.3E-07 362 407
PF13857 Ank_5 Ankyrin repeats (many copies) 3.7E-08 12 59
PF13857 Ank_5 Ankyrin repeats (many copies) 3.2E-08 346 403
PF13606 Ank_3 Ankyrin repeat 1.1E-05 360 390
PF00023 Ank Ankyrin repeat 5.4E-03 20 46
PF00023 Ank Ankyrin repeat 6.2E-06 360 392

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1 407 8.0E-21
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1 407 2.0E-20
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1 407 8.0E-20
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1 407 2.0E-19
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1 407 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1 407 8.0E-21
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1 407 2.0E-20
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1 407 8.0E-20
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1 407 2.0E-19
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1 407 2.0E-19
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1 407 4.0E-19
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 1 407 3.0E-18
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 4 403 1.0E-17
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 4 403 1.0E-17
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 20 404 1.0E-17
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 2 385 2.0E-17
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 4 403 4.0E-17
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 4 403 8.0E-17
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 8 381 3.0E-16
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 20 404 4.0E-16
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1 407 5.0E-16
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 13 381 7.0E-16
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1 407 9.0E-16
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1 403 1.0E-15
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 2 408 1.0E-15
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 21 403 1.0E-15
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 11 407 1.0E-15
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 21 407 1.0E-15
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 2 407 3.0E-15
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1 407 3.0E-15
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 1 402 3.0E-15
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 2 407 5.0E-15
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 21 403 5.0E-15
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 11 382 5.0E-15
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 1 401 7.0E-15
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1 403 1.0E-14
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 2 403 1.0E-14
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1 407 1.0E-14
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1 403 2.0E-14
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1 407 2.0E-14
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1 407 2.0E-14
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 21 407 3.0E-14
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1 407 3.0E-14
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 1 402 3.0E-14
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 2 405 4.0E-14
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 2 405 6.0E-14
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1 403 6.0E-14
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1 337 6.0E-14
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 2 403 6.0E-14
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 10 405 9.0E-14
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 1 368 1.0E-13
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 2 383 1.0E-13
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 2 407 2.0E-13
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1 407 2.0E-13
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 8 381 2.0E-13
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 253 409 2.0E-13
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 10 405 4.0E-13
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1 407 4.0E-13
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 2 405 5.0E-13
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 2 368 6.0E-13
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 2 368 7.0E-13
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 125 404 8.0E-13
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 1 407 1.0E-12
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 2 405 2.0E-12
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 2 408 4.0E-12
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 1 403 4.0E-12
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 1 403 5.0E-12
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 20 382 8.0E-12
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 2 404 9.0E-12
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 1 384 9.0E-12
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1 384 2.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 189 407 3.0E-11
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 1 383 6.0E-11
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1 384 6.0E-11
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 189 407 7.0E-11
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 23 348 7.0E-11
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1 384 8.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1 403 1.0E-10
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 23 347 1.0E-10
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 2 388 1.0E-10
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 11 407 4.0E-10
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 289 419 4.0E-10
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 125 410 5.0E-10
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 130 407 5.0E-10
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 145 383 6.0E-10
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 2 414 1.0E-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 1 407 1.0E-09
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 11 404 1.0E-09
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 1 209 2.0E-09
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 11 404 2.0E-09
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 134 382 2.0E-09
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 134 382 2.0E-09
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 11 407 2.0E-09
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 135 381 3.0E-09
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 11 404 3.0E-09
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 162 382 3.0E-09
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 134 382 4.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 130 407 5.0E-09
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 1 209 5.0E-09
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 253 404 6.0E-09
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 10 407 7.0E-09
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 130 409 9.0E-09
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 18 403 1.0E-08
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 2 394 1.0E-08
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 134 382 1.0E-08
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 2 447 2.0E-08
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 191 410 2.0E-08
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 128 403 2.0E-08
sp|Q24145|SHARK_DROME Tyrosine-protein kinase shark OS=Drosophila melanogaster GN=shark PE=2 SV=2 287 440 3.0E-08
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 165 403 4.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 130 407 4.0E-08
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 13 443 5.0E-08
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 289 407 5.0E-08
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 289 404 6.0E-08
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 77 381 7.0E-08
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 12 228 9.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 13 443 1.0E-07
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 20 407 1.0E-07
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 5 381 2.0E-07
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 134 407 2.0E-07
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 7 380 2.0E-07
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 5 236 2.0E-07
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 125 241 2.0E-07
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 125 241 2.0E-07
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 125 241 2.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 1 227 2.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 13 443 3.0E-07
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 155 407 3.0E-07
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 20 381 3.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 20 237 3.0E-07
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 10 442 3.0E-07
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 275 407 3.0E-07
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 20 237 4.0E-07
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 20 237 4.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 20 237 4.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 20 237 4.0E-07
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 288 418 5.0E-07
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 288 418 5.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 288 418 5.0E-07
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 5 230 5.0E-07
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 23 230 5.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 1 227 5.0E-07
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 1 88 5.0E-07
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 20 381 6.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 288 418 6.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 288 418 6.0E-07
sp|Q5ZXN6|ANKX_LEGPH Phosphocholine transferase AnkX OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ankX PE=1 SV=1 1 332 6.0E-07
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 1 88 6.0E-07
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 1 88 6.0E-07
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 125 241 6.0E-07
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 289 407 7.0E-07
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 288 418 7.0E-07
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 125 241 8.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 16 312 8.0E-07
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 1 88 8.0E-07
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 269 398 8.0E-07
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 158 408 9.0E-07
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 155 381 1.0E-06
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 134 407 1.0E-06
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 2 76 1.0E-06
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 2 76 1.0E-06
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 2 79 1.0E-06
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 189 403 1.0E-06
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 1 230 1.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 9 227 1.0E-06
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 20 237 1.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 137 407 2.0E-06
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 20 237 2.0E-06
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 2 79 2.0E-06
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 20 237 2.0E-06
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 1 204 2.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 3 214 3.0E-06
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 111 403 4.0E-06
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 155 403 4.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 4 393 4.0E-06
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 2 76 4.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 13 265 4.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 2 214 4.0E-06
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 288 404 5.0E-06
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 288 404 5.0E-06
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 288 404 5.0E-06
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 288 404 5.0E-06
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 288 418 6.0E-06
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 288 418 6.0E-06
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 272 410 6.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 179 422 7.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1 206 7.0E-06
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 12 228 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2977
MVQLLICRRSELDDQDVFARTALHYAADCGAVECLRLLLEVGADAAVEDDRGDTPLYLAARARCGRGVRALLAAG
APFTLSSRPPLLLELALTTFSRDVFLCIVESLTDGPGLHLSSDALFGFLQDESCDTYKLSILLQKGLDRNQVIGD
YGCMLHYAALWGRLELVKLLCESAGSDVVDRIISENYGTPLQVAAAVGNLEIVESLLNCGASVRKGSGFYGSPIH
AAAAMPLRDDGEDDEDREKKLEAYKGIVDAILRHDSTTLHLQAGYHGTPLQFAVYGAPFEMARDGQGRLPLHLAA
AAGRFPMMRRRLVGDEVRMNSPDTHQGLHALHFAAGSGRPNVVKKLLELYPDAVRDRDVDGWTPLHWACRSSSLP
VVQALLDAPEPADPNATSLRGWTPFDVALYHGGRLTGDAGLRRRLAPAEQQPFQVLGGVAVDEEGPRPTTPREAL
QLRSGIFLECIACNCAIFGPVYECATCFQIYMCFKCFRRVTKMHPRGHVFSKMTSPEDRSIKIDPGAAYAGADNC
AVRAVRGESAGGPVCKCRITL*
Coding >Hirsu2|2977
ATGGTGCAGCTACTGATTTGCAGACGTTCCGAGCTTGACGATCAAGACGTCTTCGCCCGCACCGCCCTCCATTAT
GCCGCAGACTGTGGTGCCGTAGAGTGTCTCCGGCTACTGCTCGAGGTCGGCGCCGACGCGGCAGTCGAGGACGAT
CGGGGCGACACTCCGCTCTACCTAGCAGCCCGGGCCCGCTGCGGCCGGGGCGTCCGGGCCTTGCTTGCGGCTGGA
GCCCCGTTCACTCTTTCGAGCCGGCCCCCCTTGCTTCTCGAGCTGGCGCTGACGACCTTCTCGCGGGACGTGTTT
CTGTGCATCGTTGAGTCTCTCACCGACGGCCCGGGGCTGCACCTGTCGTCAGATGCCCTATTTGGGTTCCTGCAG
GACGAGAGCTGCGACACATACAAGTTGAGCATCCTGCTTCAGAAGGGCTTGGATCGTAACCAGGTCATTGGCGAC
TACGGCTGCATGCTCCATTATGCCGCTCTCTGGGGCAGGCTGGAACTCGTGAAGCTGTTATGCGAGTCTGCCGGG
TCCGACGTCGTCGACAGGATCATCAGCGAGAATTACGGAACTCCACTGCAGGTTGCGGCTGCGGTTGGCAACCTG
GAGATCGTCGAGAGCCTTCTCAACTGCGGCGCCAGCGTCCGCAAAGGCAGCGGCTTCTACGGCTCACCGATACAC
GCAGCTGCCGCCATGCCGTTGCGCGACGATGGTGAAGACGACGAGGATCGGGAGAAGAAGCTGGAAGCCTACAAG
GGGATCGTCGACGCGATTCTTCGGCATGACAGCACGACGCTTCACCTGCAAGCCGGCTACCACGGGACGCCGTTG
CAGTTTGCAGTCTACGGTGCCCCCTTTGAAATGGCTCGCGACGGCCAAGGCCGCCTGCCGCTGCACCTGGCCGCC
GCCGCAGGACGCTTCCCAATGATGAGAAGGAGACTCGTCGGCGACGAGGTCAGGATGAACAGCCCAGACACGCAT
CAGGGCTTGCACGCTCTGCACTTCGCAGCCGGGAGCGGACGTCCGAACGTGGTCAAGAAACTTCTTGAGCTCTAC
CCAGACGCCGTGCGGGACCGCGACGTCGACGGCTGGACTCCCCTGCACTGGGCATGTCGCAGCAGCAGCCTTCCA
GTCGTTCAGGCCCTCCTCGATGCACCCGAGCCTGCTGACCCAAACGCGACAAGCCTGCGAGGCTGGACCCCCTTC
GACGTCGCCCTCTATCACGGCGGCCGCCTCACTGGAGATGCCGGCCTGAGAAGACGGCTCGCGCCGGCCGAGCAG
CAGCCGTTCCAGGTTCTGGGGGGCGTGGCAGTCGACGAGGAGGGGCCAAGGCCGACGACGCCCAGGGAGGCTCTC
CAACTTCGCTCGGGAATCTTTCTCGAGTGCATTGCCTGTAACTGCGCGATATTCGGACCAGTCTACGAGTGTGCG
ACCTGCTTCCAGATCTACATGTGTTTCAAGTGCTTCCGTCGCGTCACCAAGATGCACCCCCGCGGGCATGTGTTT
AGCAAGATGACTTCGCCCGAGGACAGGTCGATCAAGATCGACCCGGGCGCAGCCTACGCCGGGGCAGATAACTGC
GCTGTTCGTGCCGTTCGCGGCGAGTCGGCCGGCGGGCCGGTCTGCAAGTGCCGAATCACCCTGTGA
Transcript >Hirsu2|2977
ATGGTGCAGCTACTGATTTGCAGACGTTCCGAGCTTGACGATCAAGACGTCTTCGCCCGCACCGCCCTCCATTAT
GCCGCAGACTGTGGTGCCGTAGAGTGTCTCCGGCTACTGCTCGAGGTCGGCGCCGACGCGGCAGTCGAGGACGAT
CGGGGCGACACTCCGCTCTACCTAGCAGCCCGGGCCCGCTGCGGCCGGGGCGTCCGGGCCTTGCTTGCGGCTGGA
GCCCCGTTCACTCTTTCGAGCCGGCCCCCCTTGCTTCTCGAGCTGGCGCTGACGACCTTCTCGCGGGACGTGTTT
CTGTGCATCGTTGAGTCTCTCACCGACGGCCCGGGGCTGCACCTGTCGTCAGATGCCCTATTTGGGTTCCTGCAG
GACGAGAGCTGCGACACATACAAGTTGAGCATCCTGCTTCAGAAGGGCTTGGATCGTAACCAGGTCATTGGCGAC
TACGGCTGCATGCTCCATTATGCCGCTCTCTGGGGCAGGCTGGAACTCGTGAAGCTGTTATGCGAGTCTGCCGGG
TCCGACGTCGTCGACAGGATCATCAGCGAGAATTACGGAACTCCACTGCAGGTTGCGGCTGCGGTTGGCAACCTG
GAGATCGTCGAGAGCCTTCTCAACTGCGGCGCCAGCGTCCGCAAAGGCAGCGGCTTCTACGGCTCACCGATACAC
GCAGCTGCCGCCATGCCGTTGCGCGACGATGGTGAAGACGACGAGGATCGGGAGAAGAAGCTGGAAGCCTACAAG
GGGATCGTCGACGCGATTCTTCGGCATGACAGCACGACGCTTCACCTGCAAGCCGGCTACCACGGGACGCCGTTG
CAGTTTGCAGTCTACGGTGCCCCCTTTGAAATGGCTCGCGACGGCCAAGGCCGCCTGCCGCTGCACCTGGCCGCC
GCCGCAGGACGCTTCCCAATGATGAGAAGGAGACTCGTCGGCGACGAGGTCAGGATGAACAGCCCAGACACGCAT
CAGGGCTTGCACGCTCTGCACTTCGCAGCCGGGAGCGGACGTCCGAACGTGGTCAAGAAACTTCTTGAGCTCTAC
CCAGACGCCGTGCGGGACCGCGACGTCGACGGCTGGACTCCCCTGCACTGGGCATGTCGCAGCAGCAGCCTTCCA
GTCGTTCAGGCCCTCCTCGATGCACCCGAGCCTGCTGACCCAAACGCGACAAGCCTGCGAGGCTGGACCCCCTTC
GACGTCGCCCTCTATCACGGCGGCCGCCTCACTGGAGATGCCGGCCTGAGAAGACGGCTCGCGCCGGCCGAGCAG
CAGCCGTTCCAGGTTCTGGGGGGCGTGGCAGTCGACGAGGAGGGGCCAAGGCCGACGACGCCCAGGGAGGCTCTC
CAACTTCGCTCGGGAATCTTTCTCGAGTGCATTGCCTGTAACTGCGCGATATTCGGACCAGTCTACGAGTGTGCG
ACCTGCTTCCAGATCTACATGTGTTTCAAGTGCTTCCGTCGCGTCACCAAGATGCACCCCCGCGGGCATGTGTTT
AGCAAGATGACTTCGCCCGAGGACAGGTCGATCAAGATCGACCCGGGCGCAGCCTACGCCGGGGCAGATAACTGC
GCTGTTCGTGCCGTTCGCGGCGAGTCGGCCGGCGGGCCGGTCTGCAAGTGCCGAATCACCCTGTGA
Gene >Hirsu2|2977
ATGGTGCAGCTACTGATTTGCAGACGTTCCGAGCTTGACGATCAAGACGTCTTCGCCCGCACCGCCCTCCATTAT
GCCGCAGACTGTGGTGCCGTAGAGTGTCTCCGGCTACTGCTCGAGGTCGGCGCCGACGCGGCAGTCGAGGACGAT
CGGGGCGACACTCCGCTCTACCTAGCAGCCCGGGCCCGCTGCGGCCGGGGCGTCCGGGCCTTGCTTGCGGCTGGA
GCCCCGTTCACTCTTTCGAGCCGGCCCCCCTTGCTTCTCGAGCTGGCGCTGACGACCTTCTCGCGGGACGTGTTT
CTGTGCATCGTTGAGTCTCTCACCGACGGCCCGGGGCTGCACCTGTCGTCAGATGCCCTATTTGGGTTCCTGCAG
GACGAGAGCTGCGACACATACAAGTTGAGCATCCTGCTTCAGAAGGGCTTGGATCGTAACCAGGTCATTGGCGAC
TACGGCTGCATGCTCCATTATGCCGCTCTCTGGGGCAGGCTGGAACTCGTGAAGCTGTTATGCGAGTCTGCCGGG
TCCGACGTCGTCGACAGGATCATCAGCGAGAATTACGGAACTCCACTGCAGGTTGCGGCTGCGGTTGGCAACCTG
GAGATCGTCGAGAGCCTTCTCAACTGCGGCGCCAGCGTCCGCAAAGGCAGCGGCTTCTACGGCTCACCGATACAC
GCAGCTGCCGCCATGCCGTTGCGCGACGATGGTGAAGACGACGAGGATCGGGAGAAGAAGCTGGAAGCCTACAAG
GGGATCGTCGACGCGATTCTTCGGCATGACAGCACGACGCTTCACCTGCAAGCCGGCTACCACGGGACGCCGTTG
CAGTTTGCAGTCTACGGTGCCCCCTTTGAAATGGTCAGGCACCTCCTTCACGGCAGGCCGAGGTCAACAAGTCTG
GCCGGCGCATTCGGCACGCCGCTTCATCTCGCGGCTTTCCTGGGGCGTCCTCTCGTCGCTCGCAGGTTGATTCGC
AGACAAGACTGGCCCCTACAGGCTCGCGACGGCCAAGGCCGCCTGCCGCTGCACCTGGCCGCCGCCGCAGGACGC
TTCCCAATGATGAGAAGGAGACTCGTCGGCGACGAGGTCAGGATGAACAGCCCAGACACGCATCAGGGCTTGCAC
GCTCTGCACTTCGCAGCCGGGAGCGGACGTCCGAACGTGGTCAAGAAACTTCTTGAGCTCTACCCAGACGCCGTG
CGGGACCGCGACGTCGACGGCTGGACTCCCCTGCACTGGGCATGTCGCAGCAGCAGCCTTCCAGTCGTTCAGGCC
CTCCTCGATGCACCCGAGCCTGCTGACCCAAACGCGACAAGCCTGCGAGGCTGGACCCCCTTCGACGTCGCCCTC
TATCACGGCGGCCGCCTCACTGGAGATGCCGGCCTGAGAAGACGGCTCGCGCCGGCCGAGCAGCAGCCGTTCCAG
GTTCTGGGGGGCGTGGCAGTCGACGAGGAGGGGCCAAGGCCGACGACGCCCAGGGAGGCTCTCCAACTTCGCTCG
GGAATCTTTCTCGAGTGCATTGCCTGTAACTGCGTGAGTGCCCGAGTCCCAGGAGGCACTCAAGAGCTATGAATA
CTGACAGACTCTGCGCAGGCGATATTCGGACCAGTCTACGAGTGTGCGACCTGCTTCCAGATCTACATGTGTTTC
AAGTGCTTCCGTCGCGTCACCAAGATGCACCCCCGCGGGCATGTGTTTAGCAAGATGACTTCGCCCGAGGACAGG
TCGATCAAGATCGACCCGGGCGCAGCCTACGCCGGGGCAGATAACTGCGCTGTTCGTGCCGTTCGCGGCGAGTCG
GCCGGCGGGCCGGTCTGCAAGTGCCGAATCACCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail