Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2974
Gene name
LocationContig_175:1209..2448
Strand-
Gene length (bp)1239
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 3.6E-14 88 311

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6019 0.4415 0.5779 0.1228 0.1778 0.038 0.0591 0.1253 0.0742 0.0336

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9222
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2974 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2974
MPTYFLSPVESNLPIFLLNEEYVANRFEIAEGSRDGPGGQSSSNKRRAKVLGSDGGESGRPSQWVKAVEDFLIRN
AGDLDPDEDQEGAEIKVCLIDDGVTNVGGEFSGNICAGWPEGDPWTGEEPFYNSASGHGTTMARLISSVCPNVKL
YVAKLGEWREDQERISDLQKPSVARKAAEAVEWAIEHKVHVISMSWSLVKSEANERDVEKLGDQINAAGGSANKM
LLYCSANDEGMYGSHKSLYPCGSDTKAIKTIGSATPQGNVSDQVNKDKVDHLFPGGLEEAGSCGGSSAATARAAG
LAALILSCYAKRYGRGGVQKIAGWDKMSKIFKGMEATSSKWIDVTALLRPDSTVESVVGQCESWLSAYV*
Coding >Hirsu2|2974
ATGCCGACTTATTTCCTCAGCCCCGTGGAGTCAAATTTGCCGATCTTTCTGCTGAACGAGGAGTATGTCGCGAAC
CGGTTCGAGATCGCGGAAGGGAGCCGTGATGGCCCTGGAGGCCAGTCGAGCAGCAACAAAAGGCGGGCCAAGGTA
TTAGGCAGTGACGGGGGGGAATCGGGGAGACCCAGCCAATGGGTGAAGGCGGTTGAAGATTTCCTCATCCGCAAC
GCCGGAGACCTCGACCCGGATGAGGATCAAGAAGGGGCCGAGATCAAGGTGTGCCTGATCGACGACGGCGTGACC
AATGTCGGCGGCGAGTTCAGCGGTAACATCTGTGCCGGCTGGCCTGAAGGGGACCCGTGGACGGGCGAAGAGCCG
TTCTACAACTCTGCTTCGGGCCACGGCACCACCATGGCTCGGTTGATCTCGAGCGTGTGTCCAAACGTCAAGCTG
TACGTTGCCAAGCTCGGAGAATGGCGTGAAGATCAAGAGCGCATCAGCGATCTGCAGAAGCCTTCTGTTGCCCGA
AAGGCGGCCGAGGCTGTCGAGTGGGCCATCGAGCACAAGGTCCACGTTATTTCCATGAGCTGGAGCCTGGTGAAG
AGCGAAGCCAACGAGCGTGACGTGGAAAAACTCGGTGACCAGATCAACGCCGCCGGAGGTTCCGCCAACAAGATG
CTCCTCTACTGCTCCGCCAACGACGAGGGCATGTACGGCAGCCACAAAAGCTTGTACCCCTGCGGCTCAGACACC
AAGGCCATCAAGACCATCGGCTCTGCGACCCCGCAAGGCAACGTGTCGGATCAGGTGAACAAGGACAAGGTCGAC
CACCTGTTCCCAGGAGGGCTGGAAGAAGCGGGCTCGTGCGGGGGCAGCTCGGCGGCGACAGCTCGGGCTGCAGGT
CTCGCCGCCCTGATCCTGTCGTGTTACGCAAAGAGATACGGGCGCGGAGGCGTGCAGAAGATCGCCGGGTGGGAC
AAGATGTCCAAGATCTTCAAGGGCATGGAAGCAACCTCCAGCAAGTGGATCGACGTGACGGCCCTGCTCAGGCCT
GACTCGACTGTTGAATCTGTGGTCGGACAATGCGAGAGTTGGCTCTCGGCCTACGTATAG
Transcript >Hirsu2|2974
ATGCCGACTTATTTCCTCAGCCCCGTGGAGTCAAATTTGCCGATCTTTCTGCTGAACGAGGAGTATGTCGCGAAC
CGGTTCGAGATCGCGGAAGGGAGCCGTGATGGCCCTGGAGGCCAGTCGAGCAGCAACAAAAGGCGGGCCAAGGTA
TTAGGCAGTGACGGGGGGGAATCGGGGAGACCCAGCCAATGGGTGAAGGCGGTTGAAGATTTCCTCATCCGCAAC
GCCGGAGACCTCGACCCGGATGAGGATCAAGAAGGGGCCGAGATCAAGGTGTGCCTGATCGACGACGGCGTGACC
AATGTCGGCGGCGAGTTCAGCGGTAACATCTGTGCCGGCTGGCCTGAAGGGGACCCGTGGACGGGCGAAGAGCCG
TTCTACAACTCTGCTTCGGGCCACGGCACCACCATGGCTCGGTTGATCTCGAGCGTGTGTCCAAACGTCAAGCTG
TACGTTGCCAAGCTCGGAGAATGGCGTGAAGATCAAGAGCGCATCAGCGATCTGCAGAAGCCTTCTGTTGCCCGA
AAGGCGGCCGAGGCTGTCGAGTGGGCCATCGAGCACAAGGTCCACGTTATTTCCATGAGCTGGAGCCTGGTGAAG
AGCGAAGCCAACGAGCGTGACGTGGAAAAACTCGGTGACCAGATCAACGCCGCCGGAGGTTCCGCCAACAAGATG
CTCCTCTACTGCTCCGCCAACGACGAGGGCATGTACGGCAGCCACAAAAGCTTGTACCCCTGCGGCTCAGACACC
AAGGCCATCAAGACCATCGGCTCTGCGACCCCGCAAGGCAACGTGTCGGATCAGGTGAACAAGGACAAGGTCGAC
CACCTGTTCCCAGGAGGGCTGGAAGAAGCGGGCTCGTGCGGGGGCAGCTCGGCGGCGACAGCTCGGGCTGCAGGT
CTCGCCGCCCTGATCCTGTCGTGTTACGCAAAGAGATACGGGCGCGGAGGCGTGCAGAAGATCGCCGGGTGGGAC
AAGATGTCCAAGATCTTCAAGGGCATGGAAGCAACCTCCAGCAAGTGGATCGACGTGACGGCCCTGCTCAGGCCT
GACTCGACTGTTGAATCTGTGGTCGGACAATGCGAGAGTTGGCTCTCGGCCTACGTATAG
Gene >Hirsu2|2974
ATGCCGACTTATTTCCTCAGCCCCGTGGAGTCAAATTTGCCGATCTTTCTGCTGAACGAGGAGTATGTCGCGAAC
CGGTTCGAGATCGCGGAAGGGAGCCGTGATGGCCCTGGAGGCCAGTCGAGCAGCAACAAAAGGCGGGCCAAGGTA
TTAGGCAGTGACGGGGGGGAATCGGGGTGAGTCGACACGATGAATACGACATGTCCTGTCCGAGTTTCTGACAGC
AATCCAGGAGACCCAGCCAATGGGTGAAGGCGGTTGAAGATTTCCTCATCCGCAACGCCGGAGACCTCGACCCGG
ATGAGGATCAAGAAGGGGCCGAGATCAAGGTGTGCCTGATCGACGACGGCGTGACCAATGTCGGCGGCGAGTTCA
GCGGTAACATCTGTGCCGGCTGGCCTGAAGGGGACCCGTGGACGGGCGAAGAGCCGTTCTACAACTCTGCTTCGG
GCCACGGCACCACCATGGCTCGGTTGATCTCGAGCGTGTGTCCAAACGTCAAGCTGTACGTTGCCAAGCTCGGAG
AATGGCGTGAAGATCAAGAGCGCATCAGCGATCTGCAGAAGCCTTCTGTTGCCCGAAAGGCGGCCGAGGTTCGTC
CCCTTGACCAAACTCCTTGTCCGAGCATTCTCGACTGACGAGCTCCCTTTCTGCGCCGGCACTCAGGCTGTCGAG
TGGGCCATCGAGCACAAGGTCCACGTTATTTCCATGAGCTGGAGCCTGGTGAAGAGCGAAGCCAACGAGCGTGAC
GTGGAAAAACTCGGTGACCAGATCAACGCCGCCGGAGGTTCCGCCAACAAGATGCTCCTCTACTGCTCCGCCAAC
GACGAGGGCATGTACGGCAGCCACAAAAGCTTGTACCCCTGCGGCTCAGACACCAAGGCCATCAAGACCATCGGC
TCTGCGACCCCGCAAGGCAACGTGTCGGATCAGGTGAACAAGGACAAGGTCGACCACCTGTTCCCAGGAGGGCTG
GAAGAAGCGGGCTCGTGCGGGGGCAGCTCGGCGGCGACAGCTCGGGCTGCAGGTCTCGCCGCCCTGATCCTGTCG
TGTTACGCAAAGAGATACGGGCGCGGAGGCGTGCAGAAGATCGCCGGGTGGGACAAGATGTCCAAGATCTTCAAG
GGCATGGAAGCAACCTCCAGCAAGTGGATCGACGTGACGGCCCTGCTCAGGCCTGACTCGACTGTTGAATCTGTG
GTCGGACAATGCGAGAGTTGGCTCTCGGCCTACGTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail