Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2972
Gene name
LocationContig_1749:2618..4441
Strand+
Gene length (bp)1823
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 5.5E-21 259 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 106 480 7.0E-34
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 109 459 2.0E-31
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 136 480 1.0E-30
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 109 459 5.0E-30
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 136 480 1.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 106 480 7.0E-34
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 109 459 2.0E-31
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 136 480 1.0E-30
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 109 459 5.0E-30
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 136 480 1.0E-29
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 156 455 8.0E-20
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 156 453 2.0E-19
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 141 456 4.0E-15
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 141 455 3.0E-13
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 147 476 7.0E-11
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 116 455 8.0E-11
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 156 456 4.0E-10
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 156 456 2.0E-09
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 293 452 2.0E-09
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 128 478 6.0E-09
sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 299 452 7.0E-09
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 158 455 8.0E-09
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 306 466 9.0E-09
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 302 458 1.0E-08
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 162 469 2.0E-08
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 279 451 4.0E-08
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 302 455 6.0E-08
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 302 464 6.0E-08
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 302 455 2.0E-07
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 306 451 8.0E-07
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 306 451 8.0E-07
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 289 462 1.0E-06
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 293 443 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5865 0.2059 0.1658 0.1388 0.3639 0.2762 0.3301 0.3337 0.4918 0.4716

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup781
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|501
Ophiocordyceps australis map64 (Brazil) OphauB2|3062
Ophiocordyceps camponoti-floridani Ophcf2|00878
Ophiocordyceps camponoti-rufipedis Ophun1|5296
Ophiocordyceps kimflemingae Ophio5|1570
Ophiocordyceps subramaniannii Hirsu2|2972 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2972
MGRFKVPSWLQPTSSDIEKKKHNRRSFSGFSHFRSKQDGSLPVTNNVAVEECKPPIKSRLAELARKIATETEKLD
TYVKDNRLPEPGFGVDAPDEFPQLPADLRRSREEIIQAARELESLMRGPRESVRWAVWSYLDVLSLQVINSFEIA
KLVPLDAPISLAELQTKTSLDPVNLARVLRLAMTNRIFREVSPGVIGHTASSRLLAQDVGLQDWVGFNSEEVFPA
AAKVLSALRAYPEATSLTTTGFNFAFDTVGKEPMFVTFGKDPARARRMGGAMASLSGGEGYEVRHFVDNYDLSGV
DEKRGTFVDIGGSHGFVSVELARKWKNTTFVVQDLPKTVDSAPRPICDDASVGARIRLQAHDFFEEQPVKDADVY
FFRWIFHNYSTPYAIRLLRNLIPALRPGARVVINDLCLRDPGAEEPWDERLIRGMDLTMLVLLNAQERDEQQFRA
LFEAADERFVFKGVTRTDDCRMSIVEAVWEPKTEPTLEPATESATEPATEPATAGDAAQAGE*
Coding >Hirsu2|2972
ATGGGCAGATTCAAGGTGCCGTCCTGGCTTCAGCCAACGTCGTCCGACATCGAGAAAAAGAAGCACAACCGCCGC
TCCTTCTCCGGCTTCTCCCACTTCAGGTCCAAGCAAGATGGATCTCTACCCGTCACCAACAATGTCGCCGTGGAG
GAATGCAAGCCGCCAATCAAATCTCGCCTGGCCGAGCTCGCCCGCAAAATCGCAACCGAGACCGAGAAGCTGGAC
ACGTACGTCAAGGACAACCGTCTGCCAGAGCCAGGCTTTGGCGTCGACGCCCCGGACGAGTTCCCGCAGCTGCCG
GCGGATTTGCGGAGAAGCCGGGAGGAGATTATACAAGCCGCGCGGGAACTGGAGAGCCTGATGAGGGGGCCCCGA
GAGAGTGTGCGGTGGGCCGTGTGGAGTTATTTGGACGTTCTGAGCCTCCAAGTCATCAACAGCTTCGAGATTGCG
AAACTGGTCCCTCTGGACGCTCCCATCTCGCTTGCGGAGCTGCAGACCAAGACGTCGCTGGACCCGGTCAATCTC
GCACGAGTGCTGCGCCTGGCAATGACCAACCGCATCTTCCGCGAGGTCTCGCCTGGTGTCATTGGCCACACGGCC
TCGTCCCGCCTCCTTGCACAAGATGTCGGGCTGCAAGATTGGGTCGGCTTCAACTCGGAGGAGGTGTTCCCCGCC
GCCGCCAAGGTGCTTTCCGCCCTCAGGGCCTACCCGGAAGCCACCTCGTTGACCACGACCGGCTTCAACTTTGCC
TTTGACACTGTCGGCAAGGAGCCCATGTTCGTCACGTTCGGCAAGGACCCTGCTCGCGCGAGGCGGATGGGCGGG
GCCATGGCGAGCCTGTCGGGCGGAGAGGGCTACGAAGTAAGACATTTTGTCGACAATTACGACTTGTCGGGCGTC
GACGAGAAGCGGGGGACCTTTGTTGATATCGGGGGAAGTCATGGGTTTGTGTCGGTGGAGTTGGCAAGGAAATGG
AAGAACACGACGTTTGTTGTGCAGGATCTCCCAAAGACGGTGGACAGCGCGCCGAGGCCCATCTGCGACGACGCG
TCGGTTGGGGCGAGAATACGGCTGCAAGCCCACGACTTCTTCGAGGAGCAGCCCGTCAAGGACGCTGACGTGTAC
TTTTTCCGCTGGATATTCCACAACTACTCCACGCCATACGCCATAAGGCTGCTCCGGAACCTGATACCCGCCCTC
AGGCCAGGCGCTCGAGTCGTCATAAACGACCTCTGCCTGCGCGACCCAGGGGCCGAGGAGCCGTGGGACGAAAGG
CTGATACGGGGCATGGACCTGACCATGCTGGTCCTGCTTAACGCGCAGGAGCGGGACGAGCAGCAGTTTCGCGCG
CTCTTCGAGGCGGCGGACGAGCGATTTGTCTTCAAGGGCGTGACGCGGACCGACGATTGCCGGATGAGCATAGTC
GAAGCTGTGTGGGAGCCGAAGACGGAGCCGACCTTGGAGCCAGCCACGGAGTCGGCCACGGAGCCGGCAACAGAG
CCGGCCACTGCCGGGGACGCCGCCCAAGCTGGCGAGTGA
Transcript >Hirsu2|2972
ATGGGCAGATTCAAGGTGCCGTCCTGGCTTCAGCCAACGTCGTCCGACATCGAGAAAAAGAAGCACAACCGCCGC
TCCTTCTCCGGCTTCTCCCACTTCAGGTCCAAGCAAGATGGATCTCTACCCGTCACCAACAATGTCGCCGTGGAG
GAATGCAAGCCGCCAATCAAATCTCGCCTGGCCGAGCTCGCCCGCAAAATCGCAACCGAGACCGAGAAGCTGGAC
ACGTACGTCAAGGACAACCGTCTGCCAGAGCCAGGCTTTGGCGTCGACGCCCCGGACGAGTTCCCGCAGCTGCCG
GCGGATTTGCGGAGAAGCCGGGAGGAGATTATACAAGCCGCGCGGGAACTGGAGAGCCTGATGAGGGGGCCCCGA
GAGAGTGTGCGGTGGGCCGTGTGGAGTTATTTGGACGTTCTGAGCCTCCAAGTCATCAACAGCTTCGAGATTGCG
AAACTGGTCCCTCTGGACGCTCCCATCTCGCTTGCGGAGCTGCAGACCAAGACGTCGCTGGACCCGGTCAATCTC
GCACGAGTGCTGCGCCTGGCAATGACCAACCGCATCTTCCGCGAGGTCTCGCCTGGTGTCATTGGCCACACGGCC
TCGTCCCGCCTCCTTGCACAAGATGTCGGGCTGCAAGATTGGGTCGGCTTCAACTCGGAGGAGGTGTTCCCCGCC
GCCGCCAAGGTGCTTTCCGCCCTCAGGGCCTACCCGGAAGCCACCTCGTTGACCACGACCGGCTTCAACTTTGCC
TTTGACACTGTCGGCAAGGAGCCCATGTTCGTCACGTTCGGCAAGGACCCTGCTCGCGCGAGGCGGATGGGCGGG
GCCATGGCGAGCCTGTCGGGCGGAGAGGGCTACGAAGTAAGACATTTTGTCGACAATTACGACTTGTCGGGCGTC
GACGAGAAGCGGGGGACCTTTGTTGATATCGGGGGAAGTCATGGGTTTGTGTCGGTGGAGTTGGCAAGGAAATGG
AAGAACACGACGTTTGTTGTGCAGGATCTCCCAAAGACGGTGGACAGCGCGCCGAGGCCCATCTGCGACGACGCG
TCGGTTGGGGCGAGAATACGGCTGCAAGCCCACGACTTCTTCGAGGAGCAGCCCGTCAAGGACGCTGACGTGTAC
TTTTTCCGCTGGATATTCCACAACTACTCCACGCCATACGCCATAAGGCTGCTCCGGAACCTGATACCCGCCCTC
AGGCCAGGCGCTCGAGTCGTCATAAACGACCTCTGCCTGCGCGACCCAGGGGCCGAGGAGCCGTGGGACGAAAGG
CTGATACGGGGCATGGACCTGACCATGCTGGTCCTGCTTAACGCGCAGGAGCGGGACGAGCAGCAGTTTCGCGCG
CTCTTCGAGGCGGCGGACGAGCGATTTGTCTTCAAGGGCGTGACGCGGACCGACGATTGCCGGATGAGCATAGTC
GAAGCTGTGTGGGAGCCGAAGACGGAGCCGACCTTGGAGCCAGCCACGGAGTCGGCCACGGAGCCGGCAACAGAG
CCGGCCACTGCCGGGGACGCCGCCCAAGCTGGCGAGTGA
Gene >Hirsu2|2972
ATGGGCAGATTCAAGGTGCCGTCCTGGCTTCAGCCAACGTCGTCCGACATCGAGAAAAAGAAGCACAACCGCCGC
TCCTTCTCCGGCTTCTCCCACTTCAGGTCCAAGCAAGATGGATCTCTACCCGTCACCAACAATGTCGCCGTGGAG
GAATGCAAGCCGCCAATCAAATCTCGCCTGGCCGAGCTCGCCCGCAAAATCGCAACCGAGACCGAGAAGCTGGAC
ACGTACGTCAAGGACAACCGTCTGCCAGAGCCAGGCTTTGGCGTCGACGCCCCGGACGAGTTCCCGCAGCTGCCG
GCGGATTTGCGGAGAAGCCGGGAGGAGATTATACAAGCCGCGCGGGAACTGGAGAGCCTGATGAGGGGGCCCCGA
GAGAGTGTGCGGTGGGCCGTGTGGAGTGTAAGTCAAGCTTTGACCCGACGTCGCGGCCCGGCTAACACCCAGCGC
GCAGTATTTGGACGTTCTGAGCCTCCAAGTCATCAACAGCTTCGAGATTGGTGTGTCCCCGGCAGAAGATGAACG
AGACCTTTGTCAGAAAAAACAAACAAAAAGAGGGCCGTGGTGAGCTGATTCGGAACTAGCGAAACTGGTCCCTCT
GGACGCTCCCATCTCGCTTGCGGAGCTGCAGACCAAGACGTCGCTGGACCCGGTCAATCTCGCACGAGTGCTGCG
CCTGGCAATGACCAACCGCATCTTCCGCGAGGTCTCGCCTGGTGTCATTGGCCACACGGCCTCGTCCCGCCTCCT
TGCACAAGATGTCGGGCTGCAAGATTGGGTCGGCTTCAACTCGGAGGAGGTGTTCCCCGCCGCCGCCAAGGTGCT
TTCCGCCCTCAGGGCCTACCCGGAAGCCACCTCGTTGACCACGACCGGCTTCAACTTTGCCTTTGACACTGTCGG
CAAGGAGCCCATGTTCGTCACGTTCGGCAAGGACCCTGCTCGCGCGAGGCGGATGGGCGGGGCCATGGCGAGCCT
GTCGGGCGGAGAGGGCTACGAAGTAAGACATTTTGTCGACAATTACGACTTGTCGGGCGTCGACGAGAAGCGGGG
GACCTTTGTTGATATCGGGGGAAGTCATGGGTTTGTGTCGGTGGAGTTGGCAAGGAAATGGAAGAACACGACGTT
TGTTGTGCAGGATCTCCCAAAGACGGTGGACAGCGCGCCGAGGCCCATCTGCGACGACGCGTCGGTTGGGGCGAG
AATACGGCTGCAAGCCCACGACTTCTTCGAGGAGCAGCCCGTCAAGGACGCTGACGGTAGGCCGGCCTCGGGGCG
AGCGCGGACGGCTGAATCGAGGTGCCGGATGCTGACGTACCGGCACAGTGTACTTTTTCCGCTGGATATTCCACA
ACTACTCCACGCCATACGCCATAAGGCTGCTCCGGAACCTGATACCCGCCCTCAGGCCAGGCGCTCGAGTCGTCA
TAAACGACCTCTGCCTGCGCGACCCAGGGGCCGAGGAGCCGTGGGACGAAAGGCTGATACGGGGCATGGACCTGA
CCATGCTGGTCCTGCTTAACGCGCAGGAGCGGGACGAGCAGCAGTTTCGCGCGCTCTTCGAGGCGGCGGACGAGC
GATTTGTCTTCAAGGTGAGGAGGAGGGCCACGGCGGGCCCGCGGCGACGTCGACGACGTGCCCGAAGGTCCGACG
ATGCTGACGAGCCGCACCAGGGCGTGACGCGGACCGACGATTGCCGGATGAGCATAGTCGAAGCTGTGTGGGAGC
CGAAGACGGAGCCGACCTTGGAGCCAGCCACGGAGTCGGCCACGGAGCCGGCAACAGAGCCGGCCACTGCCGGGG
ACGCCGCCCAAGCTGGCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail