Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2970
Gene name
LocationContig_1748:659..1425
Strand-
Gene length (bp)766
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1486 0.0759 0.8515 0.1319 0.095 0.0193 0.0946 0.1366 0.0838 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6992
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2970 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6386
Ophiocordyceps subramaniannii Hirsu2|7973

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2970
MKYAPILAAAAGMCAARSLNTTCGKTEKPKPFFINGAEKGSCRHFFDKVQREACFGTEFWCSDKDNLQLEEDEIE
SEECLAARYCKEDGIDVPALGPCHHNIVKTREFDLFKFCTPFWAGTRPEEMPMNQTEQQLLPDCKNSTVIYNLCM
TWKPFKPLKVPAAAEHEEGKMMPLNQTEQQLLPDCKNPTVPYNLCMTWQPIKPLKVPAAAEHEEGSAGQDSDGSV
AAGGDWTAGK*
Coding >Hirsu2|2970
ATGAAGTACGCGCCAATCCTCGCCGCCGCCGCCGGCATGTGCGCCGCGCGGTCGCTGAACACGACATGCGGGAAA
ACCGAAAAACCCAAGCCGTTCTTCATTAATGGCGCAGAAAAGGGGTCCTGCAGACACTTCTTCGACAAGGTCCAA
AGGGAGGCATGCTTCGGTACGGAATTTTGGTGTAGCGACAAAGATAACCTGCAGCTTGAAGAAGATGAGATTGAG
AGCGAGGAGTGCCTGGCCGCGCGATACTGCAAAGAGGACGGCATCGACGTGCCCGCGCTCGGGCCCTGCCACCAC
AACATCGTGAAGACACGAGAATTCGACCTGTTCAAATTCTGCACGCCGTTCTGGGCCGGCACGCGGCCGGAAGAG
ATGCCCATGAACCAGACGGAGCAGCAGCTTCTGCCGGACTGCAAGAATTCTACCGTAATTTACAACCTGTGCATG
ACGTGGAAGCCGTTCAAGCCGCTCAAGGTCCCAGCTGCCGCGGAGCATGAGGAGGGAAAGATGATGCCCTTGAAC
CAGACGGAGCAGCAGCTTCTGCCGGACTGCAAGAATCCCACCGTACCTTACAACCTGTGCATGACGTGGCAGCCG
ATCAAGCCGCTCAAGGTCCCAGCTGCCGCGGAGCATGAGGAGGGAAGTGCGGGACAAGATAGCGACGGGTCAGTG
GCAGCCGGTGGAGATTGGACAGCAGGCAAATAA
Transcript >Hirsu2|2970
ATGAAGTACGCGCCAATCCTCGCCGCCGCCGCCGGCATGTGCGCCGCGCGGTCGCTGAACACGACATGCGGGAAA
ACCGAAAAACCCAAGCCGTTCTTCATTAATGGCGCAGAAAAGGGGTCCTGCAGACACTTCTTCGACAAGGTCCAA
AGGGAGGCATGCTTCGGTACGGAATTTTGGTGTAGCGACAAAGATAACCTGCAGCTTGAAGAAGATGAGATTGAG
AGCGAGGAGTGCCTGGCCGCGCGATACTGCAAAGAGGACGGCATCGACGTGCCCGCGCTCGGGCCCTGCCACCAC
AACATCGTGAAGACACGAGAATTCGACCTGTTCAAATTCTGCACGCCGTTCTGGGCCGGCACGCGGCCGGAAGAG
ATGCCCATGAACCAGACGGAGCAGCAGCTTCTGCCGGACTGCAAGAATTCTACCGTAATTTACAACCTGTGCATG
ACGTGGAAGCCGTTCAAGCCGCTCAAGGTCCCAGCTGCCGCGGAGCATGAGGAGGGAAAGATGATGCCCTTGAAC
CAGACGGAGCAGCAGCTTCTGCCGGACTGCAAGAATCCCACCGTACCTTACAACCTGTGCATGACGTGGCAGCCG
ATCAAGCCGCTCAAGGTCCCAGCTGCCGCGGAGCATGAGGAGGGAAGTGCGGGACAAGATAGCGACGGGTCAGTG
GCAGCCGGTGGAGATTGGACAGCAGGCAAATAA
Gene >Hirsu2|2970
ATGAAGTACGCGCCAATCCTCGCCGCCGCCGCCGGCATGTGCGCCGCGCGGTCGCTGAACACGACATGCGGGAAA
ACCGAAAAACCCAAGCCGTTCTTCATTAATGGCGCAGAAAAGGGGTCCTGCAGACACTTCTTCGACAAGGTCCAA
AGGGAGGCATGCTTCGGTACGGAATTTTGGTGTAGCGACAAAGATAACCTGCAGCTTGAAGAAGATGAGATTGAG
AGCGAGGAGTGCCTGGCCGCGCGATACTGCAAAGAGGACGGCATCGACGTGCCCGCGCTCGGGCCCTGCCACCAC
AACATCGTGAAGACACGAGAATTCGACCTGTTCAAATTCTGCACGCCGTTCTGGGCCGGCACGCGGCCGGAAGAG
ATGCCCATGAACCAGACGGAGCAGCAGCTTCTGCCGGACTGCAAGAATTCTACCGTAATTTACAACCTGTGCATG
ACGTGGAAGCCGTTCAAGCCGCTCAAGGTCCCAGCTGCCGCGGAGCATGAGGAGGGAAGTGCGGGACAAGATGAC
GACGGGTCAGTGGCAGTTCAGAACCGGTTCGCGGCCGAAAGAGATGATGCCCTTGAACCAGACGGAGCAGCAGCT
TCTGCCGGACTGCAAGAATCCCACCGTACCTTACAACCTGTGCATGACGTGGCAGCCGATCAAGCCGCTCAAGGT
CCCAGCTGCCGCGGAGCATGAGGAGGGAAGTGCGGGACAAGATAGCGACGGGTCAGTGGCAGCCGGTGGAGATTG
GACAGCAGGCAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail