Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2956
Gene name
LocationContig_1740:3215..5082
Strand+
Gene length (bp)1867
Transcript length (bp)1755
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.6E-37 88 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 30 547 3.0E-48
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 114 521 4.0E-37
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 47 522 1.0E-33
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 65 548 2.0E-33
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 103 499 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 30 547 3.0E-48
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 114 521 4.0E-37
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 47 522 1.0E-33
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 65 548 2.0E-33
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 103 499 1.0E-17
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 103 499 1.0E-17
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 94 484 2.0E-17
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 61 386 3.0E-13
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 61 386 3.0E-13
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 51 396 3.0E-11
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 117 438 1.0E-10
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 139 403 2.0E-10
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 139 403 2.0E-10
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 61 459 7.0E-10
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 99 485 1.0E-08
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 99 485 1.0E-07
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 127 387 2.0E-07
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 102 493 1.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 83 397 1.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 83 397 1.0E-06
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 135 493 2.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 135 376 3.0E-06
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 99 403 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 115 134 19
3 141 160 19
4 170 192 22
5 204 226 22
6 236 254 18
7 275 292 17
8 302 324 22
9 345 364 19
10 379 401 22
11 408 427 19
12 437 459 22
13 468 490 22
14 510 529 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2956
MDNRFSQSNQNEYRKVQLNDHDDRNLEGWSRELGARELDVEELDGEQLDGEQLDVDQVNVRELGWQRPAEFKSAW
LELAFISSALGALAMADFIVDGFQVILPALVEPFHIPSGSQVWPSSVVTMVAGAFLFPLGRLTDMYGGYYVFNGG
LLWFTIWTVAAGFANNFVFLVLTRAMQGLGLSAFLPAGIALLGRIYRPGPRKNLIFALYGAVCPIGFFAGMLVAG
AALEVLASWRWYFWLGGAMSGLCCLSTFLTCPHDYTAVHRRTKVEVKMDWYGTLTTVPGIMLFIYAVTESTNSAQ
GLASPHVIVTLLLGILFLGLAVYVESVVESPLIPADIFHVKYVKLMLLYLLLSWGVYSMYLFYSNFYIQLVLGQS
ALVTALWYGPWAGGGLVLSTLGGIVLDRLPGHWLLNLSSISTIMAVLLFALMPAEPNYWAWVLPAMLFEAASADV
LWTVSNVFLTTSLPRHRQGLAGAIISLTLFLGDALFLTISDVVKECLGGAGLSLDAQYKGVFWTGVSIGAVAFGI
NFFIRIDKASSDLTVDEKQEAEAGLRLDRWWRRSSASSATASVADSDTVVGSETAGLLE*
Coding >Hirsu2|2956
ATGGACAACAGATTCTCTCAAAGCAACCAGAATGAGTATAGAAAAGTCCAACTGAACGACCATGACGACCGCAAC
CTGGAGGGCTGGTCTCGCGAACTCGGCGCCCGGGAACTCGACGTTGAGGAACTCGATGGCGAGCAACTCGATGGC
GAGCAACTCGACGTCGACCAAGTCAATGTCCGAGAGCTCGGCTGGCAGCGCCCCGCCGAGTTTAAGTCGGCTTGG
CTTGAGCTGGCCTTCATCTCGTCTGCGCTAGGGGCCTTGGCCATGGCCGACTTCATCGTCGACGGCTTCCAGGTC
ATCCTCCCGGCCCTCGTCGAGCCCTTCCACATCCCCTCGGGCTCGCAGGTATGGCCGTCAAGCGTGGTCACCATG
GTGGCTGGCGCGTTCCTCTTCCCGCTCGGCCGGCTGACCGATATGTACGGCGGCTATTATGTCTTTAACGGGGGC
CTACTGTGGTTTACCATTTGGACCGTGGCCGCCGGCTTTGCCAACAACTTTGTCTTCCTCGTCTTGACGCGCGCC
ATGCAGGGGCTAGGCTTATCGGCCTTTCTCCCCGCCGGCATCGCGCTACTCGGCCGTATCTACCGCCCGGGCCCG
CGCAAGAATCTCATCTTCGCGCTATACGGCGCCGTCTGCCCGATCGGCTTCTTTGCCGGTATGTTGGTGGCGGGC
GCCGCGCTCGAGGTGCTCGCCTCGTGGCGCTGGTACTTTTGGCTAGGCGGCGCCATGTCCGGCCTCTGCTGCCTG
AGCACCTTTCTCACCTGCCCGCACGACTATACGGCGGTGCACAGGAGGACAAAGGTCGAGGTCAAGATGGACTGG
TACGGCACGCTGACGACAGTGCCGGGCATCATGCTCTTCATCTACGCCGTCACCGAGAGCACCAACTCGGCGCAG
GGCCTGGCCTCGCCACACGTCATTGTCACGCTCCTGCTCGGCATCTTGTTCCTAGGCCTTGCAGTCTATGTGGAG
AGCGTGGTCGAGTCGCCTCTCATCCCGGCCGACATCTTCCACGTCAAGTACGTCAAGCTCATGCTGCTTTACCTC
CTCCTCTCGTGGGGCGTGTACTCGATGTACCTATTCTACTCCAACTTCTACATCCAACTCGTGCTGGGCCAGTCG
GCGCTAGTAACGGCCCTCTGGTACGGCCCCTGGGCCGGGGGCGGGCTCGTCCTGTCGACGCTGGGCGGCATCGTG
CTGGATAGGCTGCCGGGCCACTGGCTCCTCAACCTATCGAGCATCTCGACCATCATGGCGGTGCTCCTGTTCGCG
CTCATGCCCGCGGAGCCCAACTACTGGGCGTGGGTGCTGCCGGCCATGCTGTTCGAGGCGGCGTCGGCCGACGTG
CTGTGGACGGTGAGCAACGTGTTCCTGACGACGAGCCTGCCGCGGCACCGGCAGGGCCTGGCGGGCGCCATCATC
AGCCTGACGCTCTTCCTGGGCGACGCCCTGTTCCTGACCATCAGCGACGTGGTCAAGGAGTGCCTCGGCGGGGCG
GGCCTCAGCCTGGACGCGCAGTACAAGGGCGTCTTTTGGACGGGCGTCAGCATCGGCGCCGTCGCCTTTGGCATC
AACTTCTTCATCCGCATCGACAAGGCCAGCTCCGACTTGACGGTCGACGAGAAGCAGGAGGCCGAGGCCGGCCTT
CGCCTCGACCGCTGGTGGAGGCGCAGCTCCGCCAGCTCCGCCACGGCCTCCGTCGCCGACTCGGACACGGTCGTC
GGCTCCGAGACGGCGGGGCTTTTGGAGTAA
Transcript >Hirsu2|2956
ATGGACAACAGATTCTCTCAAAGCAACCAGAATGAGTATAGAAAAGTCCAACTGAACGACCATGACGACCGCAAC
CTGGAGGGCTGGTCTCGCGAACTCGGCGCCCGGGAACTCGACGTTGAGGAACTCGATGGCGAGCAACTCGATGGC
GAGCAACTCGACGTCGACCAAGTCAATGTCCGAGAGCTCGGCTGGCAGCGCCCCGCCGAGTTTAAGTCGGCTTGG
CTTGAGCTGGCCTTCATCTCGTCTGCGCTAGGGGCCTTGGCCATGGCCGACTTCATCGTCGACGGCTTCCAGGTC
ATCCTCCCGGCCCTCGTCGAGCCCTTCCACATCCCCTCGGGCTCGCAGGTATGGCCGTCAAGCGTGGTCACCATG
GTGGCTGGCGCGTTCCTCTTCCCGCTCGGCCGGCTGACCGATATGTACGGCGGCTATTATGTCTTTAACGGGGGC
CTACTGTGGTTTACCATTTGGACCGTGGCCGCCGGCTTTGCCAACAACTTTGTCTTCCTCGTCTTGACGCGCGCC
ATGCAGGGGCTAGGCTTATCGGCCTTTCTCCCCGCCGGCATCGCGCTACTCGGCCGTATCTACCGCCCGGGCCCG
CGCAAGAATCTCATCTTCGCGCTATACGGCGCCGTCTGCCCGATCGGCTTCTTTGCCGGTATGTTGGTGGCGGGC
GCCGCGCTCGAGGTGCTCGCCTCGTGGCGCTGGTACTTTTGGCTAGGCGGCGCCATGTCCGGCCTCTGCTGCCTG
AGCACCTTTCTCACCTGCCCGCACGACTATACGGCGGTGCACAGGAGGACAAAGGTCGAGGTCAAGATGGACTGG
TACGGCACGCTGACGACAGTGCCGGGCATCATGCTCTTCATCTACGCCGTCACCGAGAGCACCAACTCGGCGCAG
GGCCTGGCCTCGCCACACGTCATTGTCACGCTCCTGCTCGGCATCTTGTTCCTAGGCCTTGCAGTCTATGTGGAG
AGCGTGGTCGAGTCGCCTCTCATCCCGGCCGACATCTTCCACGTCAAGTACGTCAAGCTCATGCTGCTTTACCTC
CTCCTCTCGTGGGGCGTGTACTCGATGTACCTATTCTACTCCAACTTCTACATCCAACTCGTGCTGGGCCAGTCG
GCGCTAGTAACGGCCCTCTGGTACGGCCCCTGGGCCGGGGGCGGGCTCGTCCTGTCGACGCTGGGCGGCATCGTG
CTGGATAGGCTGCCGGGCCACTGGCTCCTCAACCTATCGAGCATCTCGACCATCATGGCGGTGCTCCTGTTCGCG
CTCATGCCCGCGGAGCCCAACTACTGGGCGTGGGTGCTGCCGGCCATGCTGTTCGAGGCGGCGTCGGCCGACGTG
CTGTGGACGGTGAGCAACGTGTTCCTGACGACGAGCCTGCCGCGGCACCGGCAGGGCCTGGCGGGCGCCATCATC
AGCCTGACGCTCTTCCTGGGCGACGCCCTGTTCCTGACCATCAGCGACGTGGTCAAGGAGTGCCTCGGCGGGGCG
GGCCTCAGCCTGGACGCGCAGTACAAGGGCGTCTTTTGGACGGGCGTCAGCATCGGCGCCGTCGCCTTTGGCATC
AACTTCTTCATCCGCATCGACAAGGCCAGCTCCGACTTGACGGTCGACGAGAAGCAGGAGGCCGAGGCCGGCCTT
CGCCTCGACCGCTGGTGGAGGCGCAGCTCCGCCAGCTCCGCCACGGCCTCCGTCGCCGACTCGGACACGGTCGTC
GGCTCCGAGACGGCGGGGCTTTTGGAGTAA
Gene >Hirsu2|2956
ATGGACAACAGATTCTCTCAAAGCAACCAGAATGAGTATAGAAAAGTCCAACTGAACGACCATGACGACCGCAAC
CTGGAGGGCTGGTCTCGCGAACTCGGCGCCCGGGAACTCGACGTTGAGGAACTCGATGGCGAGCAACTCGATGGC
GAGCAACTCGACGTCGACCAAGTCAATGTCCGAGAGCTCGGCTGGCAGCGCCCCGCCGAGTTTAAGTCGGCTTGG
CTTGAGCTGGCCTTCATCTCGTCTGCGCTAGGGGCCTTGGCCATGGCCGTACGCATCCTCCCACCTTTGCATTCG
AGTGCCCCTCTTGCTGACAGGCACAAGGACTTCATCGTCGACGGCTTCCAGGTCATCCTCCCGGCCCTCGTCGAG
CCCTTCCACATCCCCTCGGGCTCGCAGGTATGGCCGTCAAGCGTGGTCACCATGGTGGCTGGCGCGTTCCTCTTC
CCGCTCGGCCGGCTGACCGATATGTACGGCGGCTATTATGTCTTTAACGGGGGCCTACTGTGGTTTACCATTTGG
ACCGTGGCCGCCGGCTTTGCCAACAACTTTGTCTTCCTCGTCTTGACGCGCGCCATGCAGGGGCTAGGCTTATCG
GCCTTTCTCCCCGCCGGCATCGCGCTACTCGGCCGTATCTACCGCCCGGGCCCGCGCAAGAATCTCATCTTCGCG
CTATACGGCGCCGTCTGCCCGATCGGCTTCTTTGCCGGTATGTTGGTGGCGGGCGCCGCGCTCGAGGTGCTCGCC
TCGTGGCGCTGGTACTTTTGGCTAGGCGGCGCCATGTCCGGCCTCTGCTGCCTGAGCACCTTTCTCACCTGCCCG
CACGACTATACGGCGGTGCACAGGAGGACAAAGGTCGAGGTCAAGATGGACTGGTACGGCACGCTGACGACAGTG
CCGGGCATCATGCTCTTCATCTACGCCGTCACCGAGAGCACCAACTCGGCGCAGGGCCTGGCCTCGCCACACGTC
ATTGTCACGCTCCTGCTCGGCATCTTGTTCCTAGGCCTTGCAGTCTATGTGGAGAGCGTGGTCGAGTCGCCTCTC
ATCCCGGCCGACATCTTCCACGTCAAGTACGTCAAGCTCATGCTGCTTTACCTCCTCCTCTCGTGGGGCGTGTAC
TCGATGTACCTATTCTACTCCAACTTCTAGTAAGTGCCGCCGGACGTGCCGATGTACCGGGAAGCGCCAGCTAAC
CGGCTTGGACAGCATCCAACTCGTGCTGGGCCAGTCGGCGCTAGTAACGGCCCTCTGGTACGGCCCCTGGGCCGG
GGGCGGGCTCGTCCTGTCGACGCTGGGCGGCATCGTGCTGGATAGGCTGCCGGGCCACTGGCTCCTCAACCTATC
GAGCATCTCGACCATCATGGCGGTGCTCCTGTTCGCGCTCATGCCCGCGGAGCCCAACTACTGGGCGTGGGTGCT
GCCGGCCATGCTGTTCGAGGCGGCGTCGGCCGACGTGCTGTGGACGGTGAGCAACGTGTTCCTGACGACGAGCCT
GCCGCGGCACCGGCAGGGCCTGGCGGGCGCCATCATCAGCCTGACGCTCTTCCTGGGCGACGCCCTGTTCCTGAC
CATCAGCGACGTGGTCAAGGAGTGCCTCGGCGGGGCGGGCCTCAGCCTGGACGCGCAGTACAAGGGCGTCTTTTG
GACGGGCGTCAGCATCGGCGCCGTCGCCTTTGGCATCAACTTCTTCATCCGCATCGACAAGGCCAGCTCCGACTT
GACGGTCGACGAGAAGCAGGAGGCCGAGGCCGGCCTTCGCCTCGACCGCTGGTGGAGGCGCAGCTCCGCCAGCTC
CGCCACGGCCTCCGTCGCCGACTCGGACACGGTCGTCGGCTCCGAGACGGCGGGGCTTTTGGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail