Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2954
Gene name
LocationContig_174:27838..31977
Strand-
Gene length (bp)4139
Transcript length (bp)3876
Coding sequence length (bp)3876
Protein length (aa) 1292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08174 Anillin Cell division protein anillin 9.9E-12 967 1093
PF00169 PH PH domain 2.6E-09 1126 1242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53705|BUD4_CANAL Bud site selection protein BUD4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD4 PE=1 SV=2 875 1267 1.0E-55
sp|Q9P7Y8|MID2_SCHPO Septin ring organizing protein mid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mid2 PE=1 SV=2 877 1244 9.0E-42
sp|A7TM88|BUD4_VANPO Bud site selection protein 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=BUD4 PE=3 SV=1 874 1242 6.0E-25
sp|Q6CPC2|BUD4_KLULA Bud site selection protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUD4 PE=3 SV=1 802 1242 6.0E-24
sp|Q751K7|BUD4_ASHGO Bud site selection protein 4 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BUD4 PE=3 SV=1 860 1242 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53705|BUD4_CANAL Bud site selection protein BUD4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD4 PE=1 SV=2 875 1267 1.0E-55
sp|Q9P7Y8|MID2_SCHPO Septin ring organizing protein mid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mid2 PE=1 SV=2 877 1244 9.0E-42
sp|A7TM88|BUD4_VANPO Bud site selection protein 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=BUD4 PE=3 SV=1 874 1242 6.0E-25
sp|Q6CPC2|BUD4_KLULA Bud site selection protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUD4 PE=3 SV=1 802 1242 6.0E-24
sp|Q751K7|BUD4_ASHGO Bud site selection protein 4 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BUD4 PE=3 SV=1 860 1242 4.0E-23
sp|Q6FJ54|BUD4_CANGA Bud site selection protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BUD4 PE=3 SV=1 874 1242 1.0E-21
sp|A6ZQ47|BUD4_YEAS7 Bud site selection protein 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=BUD4 PE=3 SV=1 877 1242 1.0E-20
sp|P47136|BUD4_YEAST Bud site selection protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD4 PE=1 SV=2 877 1242 2.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2954
MLPAGGPGSSSPTRRSSIERLQKASRVRNSNILALEQKQEYDPTRLPHIERPLAKVQANAFTSPSSSGGLRSSDS
EQRAIDSKSSLSTMSPSKSSPILAPSPQIAPRAPSRDRASPTKSSLSPSKLNKGTFDPESGTWSGHSSFHEHELP
EGRFLHRHPKSVTFDAAPPQINEYEMATPDLSSIGTNSREGSYESVDDEDDEDVLYDPGHLDLQDDSFDESLEDT
DKTPVVGPDDWRGDSPMIPHGAGAENFDGSPAPEAAPTRAVAGRPGHQRTDSANSNGDHRPLPPLPGVGHARSQS
ASSAPASPGLSATAERMLGGGSHRSLPVPPPATASKSDIQNFGNGRMTLEERLKLMMLSDDGNTKTAAEQQRERR
LRRGASRERGDTPQSDSGSATGLDGEDPDDVAGDRSLLDDYQMPPRISRESIMRRVNGNKTQEQDSDYHFSSPAA
AARSSDEQQTREALDPDVPIPTTEDPAMHEAYLQEDDSVIVTRPAEDSGNDDAGGHRGASVEEDGGLRQPSIDDD
DESHYSDNEPARELSESQDADAGATTPRANSPALALTLGDKMPDLAPAVIGTALAAPALVSVGVAKHRSETAEVV
GGDDPIGQATQQGSGPVQQRPRTPETRISKPEYDGSGWGDPDNEFDDGPGTPDSVIRHPMPEDDGEARESPAIPE
RIATIKSASGSKLKTRVSNTPSDLAAMREARRQVSLEIPQVPPIPERHRNRISRDMTASVPDGVPDAKLERRSSF
KNRSLTLDLDMGLSLDQDFERVIEAQKRGYLMRQNTKLVTASDKDADPSWRARSANNSPVKQDRPQSWVIEPWNG
EARSRSPRKRPGTSSGPVPPMPGHESNATTHIHSAEEDAQSEAATIDNVERGRLFVKVMGVKDLDLPLPKNERTW
FSLTLDNGVHCVTTAWLELARNAPIGQEFELVVPNDLEFQLTLNVKLEKPAHTELPVAATKVAKPKTSTFSRVFA
SPRKRREMEMRQKAEEERFAQQQREALARRNNSPTGYELLSPIAAEDGSFGRAYVCLKEHESRCFGRPYMAEVVL
FNEWATEEESFASSVKSKRGNTAVVRRAPYKIGKLELQLLFVPRPKNAKDDEMPKSMNSCIRELRAAEERLARNW
EGHLSQQGGDCPYWRRRYFKLVGTKLTAYHEATRQPRATINLSNAKRLIDDRRALTERETSSKHGKRRRSAFAED
EEGYMFVEEGFRIRFNNGEVIDFYADTAEDKEAWMKVLSDVIGRGESGAEEETGGVRSRAKWCELVLKREEQLRR
RSEGRRSHSRSKSSLC*
Coding >Hirsu2|2954
ATGCTCCCCGCGGGCGGCCCTGGGTCGTCGTCGCCGACACGCCGTTCTTCCATCGAGCGCCTCCAGAAAGCGTCC
CGCGTCAGGAACAGCAACATCCTGGCACTCGAGCAGAAGCAGGAATATGATCCCACTCGGCTGCCGCACATCGAG
AGACCGCTCGCCAAGGTCCAAGCAAACGCCTTCACCTCGCCCTCGAGCTCCGGCGGCCTCCGCTCCTCCGACTCG
GAGCAGCGAGCCATCGACAGCAAGTCGAGTCTGTCCACCATGAGCCCCTCCAAGTCCTCCCCCATCCTCGCCCCC
AGTCCCCAGATTGCGCCCCGAGCCCCCAGCAGGGACCGCGCCTCGCCCACAAAGTCATCCCTCTCCCCCTCCAAG
CTCAACAAGGGCACCTTCGACCCCGAGTCCGGCACCTGGTCCGGCCACTCGTCCTTCCACGAGCATGAGCTGCCC
GAGGGCCGCTTCCTGCACCGCCACCCCAAGAGCGTCACCTTCGATGCCGCCCCGCCCCAGATCAACGAGTACGAG
ATGGCGACCCCGGACCTCTCGTCCATCGGAACCAACTCGCGTGAGGGCAGCTACGAGTCGGTCGATGACGAGGAC
GACGAGGACGTCCTCTACGATCCCGGCCACCTGGATCTGCAGGACGACAGCTTCGACGAGTCTCTCGAGGACACG
GACAAGACGCCCGTCGTCGGCCCGGATGACTGGAGAGGAGACAGCCCCATGATCCCCCACGGCGCCGGCGCCGAG
AATTTCGACGGGAGTCCCGCCCCCGAGGCCGCTCCGACGCGGGCAGTCGCCGGCCGCCCGGGTCACCAGCGCACC
GACTCGGCCAACTCCAACGGCGACCATCGCCCGCTGCCCCCCCTGCCCGGCGTCGGCCACGCCAGGAGCCAGTCA
GCGAGTTCCGCCCCCGCGTCGCCGGGCCTGTCTGCCACGGCCGAGAGGATGCTGGGCGGTGGCTCCCACCGAAGT
CTGCCCGTCCCCCCTCCGGCCACTGCTAGCAAGTCGGACATCCAGAACTTCGGCAACGGCAGGATGACGTTGGAG
GAGCGCCTCAAGCTCATGATGCTGTCCGACGACGGTAACACCAAGACCGCCGCGGAGCAGCAGCGCGAGCGCCGG
CTTAGAAGGGGCGCGAGCCGTGAGCGCGGAGACACCCCCCAGTCCGATTCAGGGTCGGCTACGGGCCTCGACGGC
GAGGACCCGGACGATGTCGCCGGCGACCGGTCGCTTCTGGACGACTACCAGATGCCGCCTCGCATCTCCCGCGAG
TCCATCATGCGTCGGGTCAACGGCAACAAGACGCAGGAGCAGGACTCGGACTACCACTTCTCCTCGCCCGCCGCC
GCCGCCCGTAGCTCCGACGAGCAGCAGACGCGCGAAGCACTGGATCCCGACGTGCCCATCCCCACCACCGAGGAC
CCAGCGATGCACGAGGCGTACCTGCAAGAGGACGACAGCGTCATCGTCACCCGGCCTGCCGAGGACTCGGGCAAC
GACGATGCGGGCGGCCATCGCGGCGCAAGCGTCGAGGAGGATGGCGGCCTGCGGCAACCTTCGATTGACGACGAC
GACGAGAGTCACTACTCCGACAACGAGCCCGCGCGGGAACTGTCCGAGAGCCAAGACGCCGACGCCGGCGCAACA
ACCCCGCGTGCCAACTCGCCGGCTCTGGCCCTGACCCTGGGTGACAAGATGCCCGACCTCGCCCCGGCCGTCATC
GGGACAGCACTGGCCGCACCTGCGCTGGTCTCCGTGGGCGTGGCGAAGCATCGCTCCGAGACAGCAGAGGTTGTG
GGAGGCGATGATCCCATCGGCCAGGCCACGCAGCAAGGTTCTGGCCCTGTCCAGCAGCGGCCGCGCACGCCCGAG
ACACGCATATCGAAGCCTGAATATGACGGGTCGGGGTGGGGCGACCCGGACAACGAGTTCGACGACGGCCCCGGC
ACACCCGACTCGGTGATCCGCCATCCCATGCCCGAGGACGACGGCGAGGCCCGAGAGTCGCCTGCCATCCCCGAG
CGAATTGCAACTATCAAGTCGGCATCCGGCTCGAAACTCAAGACCAGGGTCTCCAACACCCCCTCGGACCTGGCC
GCGATGCGAGAGGCCCGCCGGCAGGTCAGCCTGGAGATCCCGCAAGTCCCCCCGATCCCGGAACGGCACCGCAAC
CGCATCTCGCGGGACATGACGGCCTCTGTGCCGGACGGCGTCCCAGACGCGAAGCTTGAGCGCCGGTCAAGCTTC
AAGAACCGCAGCTTGACGCTGGATCTCGACATGGGCCTCAGCCTCGATCAGGACTTCGAGAGGGTCATCGAGGCG
CAAAAGCGAGGGTACCTCATGCGGCAGAACACGAAGCTCGTGACTGCAAGCGACAAGGACGCCGATCCATCGTGG
CGGGCCCGGTCAGCCAACAACTCTCCAGTCAAGCAGGACCGACCGCAGTCGTGGGTCATCGAGCCCTGGAACGGG
GAGGCCCGCTCGCGAAGCCCGCGGAAACGACCAGGGACCAGCAGCGGCCCAGTGCCGCCCATGCCCGGCCACGAG
AGCAATGCCACGACTCACATCCACAGCGCCGAGGAGGACGCGCAATCCGAGGCTGCCACGATAGACAACGTCGAG
AGGGGACGCCTGTTCGTCAAGGTCATGGGCGTCAAAGACCTGGATCTGCCACTTCCCAAGAATGAGCGTACTTGG
TTCAGCCTCACGCTTGATAACGGGGTTCACTGCGTCACGACGGCGTGGCTCGAGCTCGCGCGAAACGCACCGATC
GGCCAGGAGTTTGAGCTCGTCGTCCCCAACGACCTCGAGTTCCAGCTCACGCTCAACGTCAAGCTGGAGAAGCCC
GCACACACGGAGCTGCCGGTGGCGGCGACCAAGGTGGCCAAGCCCAAGACATCGACCTTTAGCAGGGTGTTTGCG
TCGCCGAGGAAGCGCAGGGAAATGGAGATGCGGCAAAAGGCCGAGGAGGAGCGCTTCGCCCAGCAGCAGAGAGAG
GCGCTCGCACGGCGCAACAACTCGCCGACGGGGTACGAGCTCTTGTCGCCGATTGCAGCCGAGGACGGGAGCTTC
GGCCGGGCCTACGTCTGTCTTAAGGAGCACGAGAGCCGGTGTTTCGGGCGCCCGTACATGGCGGAGGTGGTCTTG
TTCAACGAATGGGCCACGGAAGAGGAGAGCTTCGCGTCCAGCGTCAAGAGCAAGCGCGGCAACACGGCCGTGGTC
CGTCGGGCCCCCTACAAGATTGGAAAGCTGGAGCTCCAGCTGCTCTTCGTGCCTCGGCCTAAGAACGCCAAGGAC
GACGAGATGCCCAAGAGCATGAACTCGTGCATCAGGGAGCTGCGGGCGGCAGAGGAGAGGCTGGCCCGCAACTGG
GAGGGCCACCTGAGCCAGCAGGGGGGCGACTGTCCGTACTGGCGCCGGCGATACTTTAAGCTCGTGGGCACCAAA
CTGACGGCCTACCACGAGGCTACCCGCCAGCCGCGCGCGACGATCAACCTGTCGAACGCCAAGCGGCTGATTGAC
GACCGGCGGGCGTTGACGGAGAGGGAGACGTCGAGCAAGCACGGCAAACGGCGCCGATCGGCCTTTGCGGAAGAC
GAGGAGGGCTACATGTTTGTCGAAGAGGGCTTCCGAATCCGGTTCAACAACGGCGAAGTGATCGACTTCTACGCC
GACACGGCCGAGGACAAGGAAGCCTGGATGAAGGTGCTCTCGGACGTGATCGGGCGAGGCGAGAGCGGCGCAGAG
GAGGAAACGGGCGGCGTGCGATCGCGTGCGAAGTGGTGCGAGCTTGTCCTCAAGCGAGAAGAGCAGCTCCGCCGC
CGGTCCGAGGGCCGCCGGAGCCACTCGCGGAGCAAGAGCTCGCTCTGCTAA
Transcript >Hirsu2|2954
ATGCTCCCCGCGGGCGGCCCTGGGTCGTCGTCGCCGACACGCCGTTCTTCCATCGAGCGCCTCCAGAAAGCGTCC
CGCGTCAGGAACAGCAACATCCTGGCACTCGAGCAGAAGCAGGAATATGATCCCACTCGGCTGCCGCACATCGAG
AGACCGCTCGCCAAGGTCCAAGCAAACGCCTTCACCTCGCCCTCGAGCTCCGGCGGCCTCCGCTCCTCCGACTCG
GAGCAGCGAGCCATCGACAGCAAGTCGAGTCTGTCCACCATGAGCCCCTCCAAGTCCTCCCCCATCCTCGCCCCC
AGTCCCCAGATTGCGCCCCGAGCCCCCAGCAGGGACCGCGCCTCGCCCACAAAGTCATCCCTCTCCCCCTCCAAG
CTCAACAAGGGCACCTTCGACCCCGAGTCCGGCACCTGGTCCGGCCACTCGTCCTTCCACGAGCATGAGCTGCCC
GAGGGCCGCTTCCTGCACCGCCACCCCAAGAGCGTCACCTTCGATGCCGCCCCGCCCCAGATCAACGAGTACGAG
ATGGCGACCCCGGACCTCTCGTCCATCGGAACCAACTCGCGTGAGGGCAGCTACGAGTCGGTCGATGACGAGGAC
GACGAGGACGTCCTCTACGATCCCGGCCACCTGGATCTGCAGGACGACAGCTTCGACGAGTCTCTCGAGGACACG
GACAAGACGCCCGTCGTCGGCCCGGATGACTGGAGAGGAGACAGCCCCATGATCCCCCACGGCGCCGGCGCCGAG
AATTTCGACGGGAGTCCCGCCCCCGAGGCCGCTCCGACGCGGGCAGTCGCCGGCCGCCCGGGTCACCAGCGCACC
GACTCGGCCAACTCCAACGGCGACCATCGCCCGCTGCCCCCCCTGCCCGGCGTCGGCCACGCCAGGAGCCAGTCA
GCGAGTTCCGCCCCCGCGTCGCCGGGCCTGTCTGCCACGGCCGAGAGGATGCTGGGCGGTGGCTCCCACCGAAGT
CTGCCCGTCCCCCCTCCGGCCACTGCTAGCAAGTCGGACATCCAGAACTTCGGCAACGGCAGGATGACGTTGGAG
GAGCGCCTCAAGCTCATGATGCTGTCCGACGACGGTAACACCAAGACCGCCGCGGAGCAGCAGCGCGAGCGCCGG
CTTAGAAGGGGCGCGAGCCGTGAGCGCGGAGACACCCCCCAGTCCGATTCAGGGTCGGCTACGGGCCTCGACGGC
GAGGACCCGGACGATGTCGCCGGCGACCGGTCGCTTCTGGACGACTACCAGATGCCGCCTCGCATCTCCCGCGAG
TCCATCATGCGTCGGGTCAACGGCAACAAGACGCAGGAGCAGGACTCGGACTACCACTTCTCCTCGCCCGCCGCC
GCCGCCCGTAGCTCCGACGAGCAGCAGACGCGCGAAGCACTGGATCCCGACGTGCCCATCCCCACCACCGAGGAC
CCAGCGATGCACGAGGCGTACCTGCAAGAGGACGACAGCGTCATCGTCACCCGGCCTGCCGAGGACTCGGGCAAC
GACGATGCGGGCGGCCATCGCGGCGCAAGCGTCGAGGAGGATGGCGGCCTGCGGCAACCTTCGATTGACGACGAC
GACGAGAGTCACTACTCCGACAACGAGCCCGCGCGGGAACTGTCCGAGAGCCAAGACGCCGACGCCGGCGCAACA
ACCCCGCGTGCCAACTCGCCGGCTCTGGCCCTGACCCTGGGTGACAAGATGCCCGACCTCGCCCCGGCCGTCATC
GGGACAGCACTGGCCGCACCTGCGCTGGTCTCCGTGGGCGTGGCGAAGCATCGCTCCGAGACAGCAGAGGTTGTG
GGAGGCGATGATCCCATCGGCCAGGCCACGCAGCAAGGTTCTGGCCCTGTCCAGCAGCGGCCGCGCACGCCCGAG
ACACGCATATCGAAGCCTGAATATGACGGGTCGGGGTGGGGCGACCCGGACAACGAGTTCGACGACGGCCCCGGC
ACACCCGACTCGGTGATCCGCCATCCCATGCCCGAGGACGACGGCGAGGCCCGAGAGTCGCCTGCCATCCCCGAG
CGAATTGCAACTATCAAGTCGGCATCCGGCTCGAAACTCAAGACCAGGGTCTCCAACACCCCCTCGGACCTGGCC
GCGATGCGAGAGGCCCGCCGGCAGGTCAGCCTGGAGATCCCGCAAGTCCCCCCGATCCCGGAACGGCACCGCAAC
CGCATCTCGCGGGACATGACGGCCTCTGTGCCGGACGGCGTCCCAGACGCGAAGCTTGAGCGCCGGTCAAGCTTC
AAGAACCGCAGCTTGACGCTGGATCTCGACATGGGCCTCAGCCTCGATCAGGACTTCGAGAGGGTCATCGAGGCG
CAAAAGCGAGGGTACCTCATGCGGCAGAACACGAAGCTCGTGACTGCAAGCGACAAGGACGCCGATCCATCGTGG
CGGGCCCGGTCAGCCAACAACTCTCCAGTCAAGCAGGACCGACCGCAGTCGTGGGTCATCGAGCCCTGGAACGGG
GAGGCCCGCTCGCGAAGCCCGCGGAAACGACCAGGGACCAGCAGCGGCCCAGTGCCGCCCATGCCCGGCCACGAG
AGCAATGCCACGACTCACATCCACAGCGCCGAGGAGGACGCGCAATCCGAGGCTGCCACGATAGACAACGTCGAG
AGGGGACGCCTGTTCGTCAAGGTCATGGGCGTCAAAGACCTGGATCTGCCACTTCCCAAGAATGAGCGTACTTGG
TTCAGCCTCACGCTTGATAACGGGGTTCACTGCGTCACGACGGCGTGGCTCGAGCTCGCGCGAAACGCACCGATC
GGCCAGGAGTTTGAGCTCGTCGTCCCCAACGACCTCGAGTTCCAGCTCACGCTCAACGTCAAGCTGGAGAAGCCC
GCACACACGGAGCTGCCGGTGGCGGCGACCAAGGTGGCCAAGCCCAAGACATCGACCTTTAGCAGGGTGTTTGCG
TCGCCGAGGAAGCGCAGGGAAATGGAGATGCGGCAAAAGGCCGAGGAGGAGCGCTTCGCCCAGCAGCAGAGAGAG
GCGCTCGCACGGCGCAACAACTCGCCGACGGGGTACGAGCTCTTGTCGCCGATTGCAGCCGAGGACGGGAGCTTC
GGCCGGGCCTACGTCTGTCTTAAGGAGCACGAGAGCCGGTGTTTCGGGCGCCCGTACATGGCGGAGGTGGTCTTG
TTCAACGAATGGGCCACGGAAGAGGAGAGCTTCGCGTCCAGCGTCAAGAGCAAGCGCGGCAACACGGCCGTGGTC
CGTCGGGCCCCCTACAAGATTGGAAAGCTGGAGCTCCAGCTGCTCTTCGTGCCTCGGCCTAAGAACGCCAAGGAC
GACGAGATGCCCAAGAGCATGAACTCGTGCATCAGGGAGCTGCGGGCGGCAGAGGAGAGGCTGGCCCGCAACTGG
GAGGGCCACCTGAGCCAGCAGGGGGGCGACTGTCCGTACTGGCGCCGGCGATACTTTAAGCTCGTGGGCACCAAA
CTGACGGCCTACCACGAGGCTACCCGCCAGCCGCGCGCGACGATCAACCTGTCGAACGCCAAGCGGCTGATTGAC
GACCGGCGGGCGTTGACGGAGAGGGAGACGTCGAGCAAGCACGGCAAACGGCGCCGATCGGCCTTTGCGGAAGAC
GAGGAGGGCTACATGTTTGTCGAAGAGGGCTTCCGAATCCGGTTCAACAACGGCGAAGTGATCGACTTCTACGCC
GACACGGCCGAGGACAAGGAAGCCTGGATGAAGGTGCTCTCGGACGTGATCGGGCGAGGCGAGAGCGGCGCAGAG
GAGGAAACGGGCGGCGTGCGATCGCGTGCGAAGTGGTGCGAGCTTGTCCTCAAGCGAGAAGAGCAGCTCCGCCGC
CGGTCCGAGGGCCGCCGGAGCCACTCGCGGAGCAAGAGCTCGCTCTGCTAA
Gene >Hirsu2|2954
ATGCTCCCCGCGGGCGGCCCTGGGTCGTCGTCGCCGACACGCCGTTCTTCCATCGAGCGCCTCCAGAAAGCGTCC
CGCGTCAGGAACAGCAACATCCTGGCACTCGAGCAGAAGCAGGAATATGATCCCACTCGGCTGCCGCACATCGAG
AGACCGCTCGCCAAGGTCCAAGCAAACGCCTTCACCTCGCCCTCGAGCTCCGGCGGCCTCCGCTCCTCCGACTCG
GAGCAGCGAGCCATCGACAGCAAGTCGAGTCTGTCCACCATGAGCCCCTCCAAGTCCTCCCCCATCCTCGCCCCC
AGTCCCCAGATTGCGCCCCGAGCCCCCAGCAGGGACCGCGCCTCGCCCACAAAGTCATCCCTCTCCCCCTCCAAG
CTCAACAAGGGCACCTTCGACCCCGAGTCCGGCACCTGGTCCGGCCACTCGTCCTTCCACGAGCATGAGCTGCCC
GAGGGCCGCTTCCTGCACCGCCACCCCAAGAGCGTCACCTTCGATGCCGCCCCGCCCCAGATCAACGAGTACGAG
ATGGCGACCCCGGACCTCTCGTCCATCGGAACCAACTCGCGTGAGGGCAGCTACGAGTCGGTCGATGACGAGGAC
GACGAGGACGTCCTCTACGATCCCGGCCACCTGGATCTGCAGGACGACAGCTTCGACGAGTCTCTCGAGGACACG
GACAAGACGCCCGTCGTCGGCCCGGATGACTGGAGAGGAGACAGCCCCATGATCCCCCACGGCGCCGGCGCCGAG
AATTTCGACGGGAGTCCCGCCCCCGAGGCCGCTCCGACGCGGGCAGTCGCCGGCCGCCCGGGTCACCAGCGCACC
GACTCGGCCAACTCCAACGGCGACCATCGCCCGCTGCCCCCCCTGCCCGGCGTCGGCCACGCCAGGAGCCAGTCA
GCGAGTTCCGCCCCCGCGTCGCCGGGCCTGTCTGCCACGGCCGAGAGGATGCTGGGCGGTGGCTCCCACCGAAGT
CTGCCCGTCCCCCCTCCGGCCACTGCTAGCAAGTCGGACATCCAGAACTTCGGCAACGGCAGGATGACGTTGGAG
GAGCGCCTCAAGCTCATGATGCTGTCCGACGACGGTAACACCAAGACCGCCGCGGAGCAGCAGCGCGAGCGCCGG
CTTAGAAGGGGCGCGAGCCGTGAGCGCGGAGACACCCCCCAGTCCGATTCAGGGTCGGCTACGGGCCTCGACGGC
GAGGACCCGGACGATGTCGCCGGCGACCGGTCGCTTCTGGACGACTACCAGATGCCGCCTCGCATCTCCCGCGAG
TCCATCATGCGTCGGGTCAACGGCAACAAGACGCAGGAGCAGGACTCGGACTACCACTTCTCCTCGCCCGCCGCC
GCCGCCCGTAGCTCCGACGAGCAGCAGACGCGCGAAGCACTGGATCCCGACGTGCCCATCCCCACCACCGAGGAC
CCAGCGATGCACGAGGCGTACCTGCAAGAGGACGACAGCGTCATCGTCACCCGGCCTGCCGAGGACTCGGGCAAC
GACGATGCGGGCGGCCATCGCGGCGCAAGCGTCGAGGAGGATGGCGGCCTGCGGCAACCTTCGATTGACGACGAC
GACGAGAGTCACTACTCCGACAACGAGCCCGCGCGGGAACTGTCCGAGAGCCAAGACGCCGACGCCGGCGCAACA
ACCCCGCGTGCCAACTCGCCGGCTCTGGCCCTGACCCTGGGTGACAAGATGCCCGACCTCGCCCCGGCCGTCATC
GGGACAGCACTGGCCGCACCTGCGCTGGTCTCCGTGGGCGTGGCGAAGCATCGCTCCGAGACAGCAGAGGTTGTG
GGAGGCGATGATCCCATCGGCCAGGCCACGCAGCAAGGTTCTGGCCCTGTCCAGCAGCGGCCGCGCACGCCCGAG
ACACGCATATCGAAGCCTGAATATGACGGGTCGGGGTGGGGCGACCCGGACAACGAGTTCGACGACGGCCCCGGC
ACACCCGACTCGGTGATCCGCCATCCCATGCCCGAGGACGACGGCGAGGCCCGAGAGTCGCCTGCCATCCCCGAG
CGAATTGCAACTATCAAGTCGGCATCCGGCTCGAAACTCAAGACCAGGGTCTCCAACACCCCCTCGGACCTGGCC
GCGATGCGAGAGGCCCGCCGGCAGGTCAGCCTGGAGATCCCGCAAGTCCCCCCGATCCCGGAACGGCACCGCAAC
CGCATCTCGCGGGACATGACGGCCTCTGTGCCGGACGGCGTCCCAGACGCGAAGCTTGAGCGCCGGTCAAGCTTC
AAGAACCGCAGCTTGACGCTGGATCTCGACATGGGCCTCAGCCTCGATCAGGACTTCGAGAGGGTCATCGAGGCG
CAAAAGGTGCATCATTACTGCCCCCCTGCTCGAGCATTTGTGCCCGCGTCCCCCCGCGTCAACAGACAAGCGTCT
GGAAGGCTGCTCGCACGAGAAGCGAAAGAAGTAGATGCTAATGTGACTCAACGTCCTCAGCGAGGGTACCTCATG
CGGCAGAACACGAAGCTCGTGACTGCAAGCGACAAGGACGCCGATCCATCGTGGCGGGCCCGGTCAGCCAACAAC
TCTCCAGTCAAGCAGGACCGACCGCAGTCGTGGGTCATCGAGCCCTGGAACGGGGAGGCCCGCTCGCGAAGCCCG
CGGAAACGACCAGGGACCAGCAGCGGCCCAGTGCCGCCCATGCCCGGCCACGAGAGCAATGCCACGACTCACATC
CACAGCGCCGAGGAGGACGCGCAATCCGAGGCTGCCACGATAGACAACGTCGAGAGGGGACGCCTGTTCGTCAAG
GTCATGGGCGTCAAAGACCTGGATCTGCCACTTCCCAAGAGTTTGTGCCCCTCGCCCGTCCCGGCTCGTTTCCCT
CCCGCTGACCGAGAAGTAGATGAGCGTACTTGGTTCAGCCTCACGCTTGATAACGGGGTTCACTGCGTCACGACG
GCGTGGCTCGAGCTCGCGCGAAACGCACCGATCGGCCAGGAGTTTGAGCTCGTCGTCCCCAACGACCTCGAGTTC
CAGCTCACGCTCAACGTCAAGCTGGAGAAGCCCGCACACACGGAGCTGCCGGTGGCGGCGACCAAGGTGGCCAAG
CCCAAGACATCGACCTTTAGCAGGGTGTTTGCGTCGCCGAGGAAGCGCAGGGAAATGGAGATGCGGCAAAAGGCC
GAGGAGGAGCGCTTCGCCCAGCAGCAGAGAGAGGCGCTCGCACGGCGCAACAACTCGCCGACGGGGTACGAGCTC
TTGTCGCCGATTGCAGCCGAGGACGGGAGCTTCGGCCGGGCCTACGTCTGTCTTAAGGAGCACGAGAGCCGGTGT
TTCGGGCGCCCGTACATGGCGGAGGTGGTCTTGTTCAACGAATGGGCCACGGAAGAGGAGAGCTTCGCGTCCAGC
GTCAAGAGCAAGCGCGGCAACACGGCCGTGGTCCGTCGGGCCCCCTACAAGATTGGAAAGCTGGAGCTCCAGCTG
CTCTTCGTGCCTCGGCCTAAGAACGCCAAGGACGACGAGATGCCCAAGAGCATGAACTCGTGCATCAGGGAGCTG
CGGGCGGCAGAGGAGAGGCTGGCCCGCAACTGGGAGGGCCACCTGAGCCAGCAGGGGGGCGACTGTCCGGTAAGT
TGGTCGCGCGCCGTGGTCCGCAGGGCTGCTGGGGGCGGGGATTGGAAATGTGCTGACCAGGACGGATATTGCAGT
ACTGGCGCCGGCGATACTTTAAGCTCGTGGGCACCAAACTGACGGCCTACCACGAGGCTACCCGCCAGCCGCGCG
CGACGATCAACCTGTCGAACGCCAAGCGGCTGATTGACGACCGGCGGGCGTTGACGGAGAGGGAGACGTCGAGCA
AGCACGGCAAACGGCGCCGATCGGCCTTTGCGGAAGACGAGGAGGGCTACATGTTTGTCGAAGAGGGCTTCCGAA
TCCGGTTCAACAACGGCGAAGTGATCGACTTCTACGCCGACACGGCCGAGGACAAGGAAGCCTGGATGAAGGTGC
TCTCGGACGTGATCGGGCGAGGCGAGAGCGGCGCAGAGGAGGAAACGGGCGGCGTGCGATCGCGTGCGAAGTGGT
GCGAGCTTGTCCTCAAGCGAGAAGAGCAGCTCCGCCGCCGGTCCGAGGGCCGCCGGAGCCACTCGCGGAGCAAGA
GCTCGCTCTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail