Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2953
Gene name
LocationContig_174:22578..26340
Strand-
Gene length (bp)3762
Transcript length (bp)2322
Coding sequence length (bp)2322
Protein length (aa) 774

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08953 DUF1899 Domain of unknown function (DUF1899) 3.4E-34 4 69
PF16300 WD40_4 Type of WD40 repeat 5.4E-17 347 387
PF00400 WD40 WD domain, G-beta repeat 3.4E-03 77 109
PF00400 WD40 WD domain, G-beta repeat 2.8E-03 129 166
PF00400 WD40 WD domain, G-beta repeat 2.8E-04 173 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13923|CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crn1 PE=1 SV=1 1 604 0.0E+00
sp|Q06440|CORO_YEAST Coronin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRN1 PE=1 SV=1 1 403 3.0E-167
sp|P27133|COROA_DICDI Coronin-A OS=Dictyostelium discoideum GN=corA PE=1 SV=2 4 420 4.0E-109
sp|Q6QEF8|CORO6_HUMAN Coronin-6 OS=Homo sapiens GN=CORO6 PE=1 SV=2 1 403 2.0E-107
sp|Q920M5|CORO6_MOUSE Coronin-6 OS=Mus musculus GN=Coro6 PE=1 SV=1 1 398 1.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13923|CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crn1 PE=1 SV=1 1 604 0.0E+00
sp|Q06440|CORO_YEAST Coronin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRN1 PE=1 SV=1 1 403 3.0E-167
sp|P27133|COROA_DICDI Coronin-A OS=Dictyostelium discoideum GN=corA PE=1 SV=2 4 420 4.0E-109
sp|Q6QEF8|CORO6_HUMAN Coronin-6 OS=Homo sapiens GN=CORO6 PE=1 SV=2 1 403 2.0E-107
sp|Q920M5|CORO6_MOUSE Coronin-6 OS=Mus musculus GN=Coro6 PE=1 SV=1 1 398 1.0E-106
sp|Q9WUM4|COR1C_MOUSE Coronin-1C OS=Mus musculus GN=Coro1c PE=1 SV=2 4 441 2.0E-106
sp|Q9ULV4|COR1C_HUMAN Coronin-1C OS=Homo sapiens GN=CORO1C PE=1 SV=1 4 406 2.0E-106
sp|Q920J3|CORO6_RAT Coronin-6 OS=Rattus norvegicus GN=Coro6 PE=2 SV=2 1 470 1.0E-105
sp|Q91ZN1|COR1A_RAT Coronin-1A OS=Rattus norvegicus GN=Coro1a PE=1 SV=3 1 403 2.0E-105
sp|O89053|COR1A_MOUSE Coronin-1A OS=Mus musculus GN=Coro1a PE=1 SV=5 1 448 5.0E-105
sp|Q92176|COR1A_BOVIN Coronin-1A OS=Bos taurus GN=CORO1A PE=1 SV=3 1 403 2.0E-104
sp|Q4R4J2|COR1A_MACFA Coronin-1A OS=Macaca fascicularis GN=CORO1A PE=2 SV=3 1 441 4.0E-104
sp|P31146|COR1A_HUMAN Coronin-1A OS=Homo sapiens GN=CORO1A PE=1 SV=4 1 441 1.0E-103
sp|Q9WUM3|COR1B_MOUSE Coronin-1B OS=Mus musculus GN=Coro1b PE=1 SV=1 4 468 2.0E-101
sp|O89046|COR1B_RAT Coronin-1B OS=Rattus norvegicus GN=Coro1b PE=1 SV=1 4 449 1.0E-99
sp|Q5NVK4|COR1B_PONAB Coronin-1B OS=Pongo abelii GN=CORO1B PE=2 SV=2 4 398 2.0E-99
sp|Q9XS70|COR1B_RABIT Coronin-1B OS=Oryctolagus cuniculus GN=CORO1B PE=1 SV=1 4 398 6.0E-99
sp|Q9BR76|COR1B_HUMAN Coronin-1B OS=Homo sapiens GN=CORO1B PE=1 SV=1 4 398 2.0E-98
sp|Q92828|COR2A_HUMAN Coronin-2A OS=Homo sapiens GN=CORO2A PE=2 SV=2 7 446 3.0E-98
sp|Q8C0P5|COR2A_MOUSE Coronin-2A OS=Mus musculus GN=Coro2a PE=2 SV=1 7 384 2.0E-94
sp|A8WGE3|COR2B_XENTR Coronin-2B OS=Xenopus tropicalis GN=coro2b PE=2 SV=1 7 398 8.0E-94
sp|Q6DJD8|COR2B_XENLA Coronin-2B OS=Xenopus laevis GN=coro2b PE=2 SV=1 7 418 1.0E-93
sp|Q32LP9|COR2A_BOVIN Coronin-2A OS=Bos taurus GN=CORO2A PE=2 SV=1 7 409 9.0E-93
sp|Q8BH44|COR2B_MOUSE Coronin-2B OS=Mus musculus GN=Coro2b PE=1 SV=2 7 398 7.0E-91
sp|Q9UQ03|COR2B_HUMAN Coronin-2B OS=Homo sapiens GN=CORO2B PE=1 SV=4 7 398 1.0E-90
sp|Q21624|CORO_CAEEL Coronin-like protein cor-1 OS=Caenorhabditis elegans GN=cor-1 PE=3 SV=2 3 431 8.0E-81
sp|Q55E54|COROB_DICDI Coronin-B OS=Dictyostelium discoideum GN=corB PE=1 SV=1 7 389 7.0E-71
sp|Q55E54|COROB_DICDI Coronin-B OS=Dictyostelium discoideum GN=corB PE=1 SV=1 4 437 9.0E-61
sp|P57737|CORO7_HUMAN Coronin-7 OS=Homo sapiens GN=CORO7 PE=1 SV=2 8 449 3.0E-56
sp|Q8WQ85|VILD_DICDI Villidin OS=Dictyostelium discoideum GN=vilA PE=1 SV=2 5 405 9.0E-55
sp|Q0V8F1|CORO7_BOVIN Coronin-7 OS=Bos taurus GN=CORO7 PE=2 SV=1 8 413 4.0E-52
sp|O35828|CORO7_RAT Coronin-7 OS=Rattus norvegicus GN=Coro7 PE=1 SV=2 8 413 3.0E-51
sp|P57737|CORO7_HUMAN Coronin-7 OS=Homo sapiens GN=CORO7 PE=1 SV=2 4 439 3.0E-50
sp|Q0V8F1|CORO7_BOVIN Coronin-7 OS=Bos taurus GN=CORO7 PE=2 SV=1 4 384 8.0E-50
sp|Q9D2V7|CORO7_MOUSE Coronin-7 OS=Mus musculus GN=Coro7 PE=1 SV=2 8 413 2.0E-49
sp|Q5RBW3|CORO7_PONAB Coronin-7 OS=Pongo abelii GN=CORO7 PE=2 SV=1 4 439 2.0E-49
sp|O35828|CORO7_RAT Coronin-7 OS=Rattus norvegicus GN=Coro7 PE=1 SV=2 4 436 8.0E-46
sp|Q9D2V7|CORO7_MOUSE Coronin-7 OS=Mus musculus GN=Coro7 PE=1 SV=2 4 394 1.0E-44
sp|Q5RBW3|CORO7_PONAB Coronin-7 OS=Pongo abelii GN=CORO7 PE=2 SV=1 8 449 7.0E-44
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 77 261 4.0E-15
sp|Q9DC48|PRP17_MOUSE Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1 45 254 5.0E-15
sp|C7Z6H2|LIS1_NECH7 Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 38 213 7.0E-15
sp|Q4ICM0|LIS1_GIBZE Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 78 346 1.0E-14
sp|O60508|PRP17_HUMAN Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 66 254 3.0E-14
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 77 221 8.0E-14
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 77 226 9.0E-14
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 74 228 1.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 96 228 1.0E-13
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 66 213 1.0E-13
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 66 346 1.0E-13
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 73 221 1.0E-13
sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 38 217 1.0E-13
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 97 241 1.0E-13
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 97 241 1.0E-13
sp|P0CS36|HAT2_CRYNJ Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1 76 208 2.0E-13
sp|P0CS37|HAT2_CRYNB Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1 76 208 2.0E-13
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 73 214 2.0E-13
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 47 222 3.0E-13
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 97 241 3.0E-13
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 72 226 3.0E-13
sp|Q6INH0|RBP4B_XENLA Histone-binding protein RBBP4-B OS=Xenopus laevis GN=rbbp4-b PE=1 SV=3 38 210 5.0E-13
sp|Q5M7K4|RBBP4_XENTR Histone-binding protein RBBP4 OS=Xenopus tropicalis GN=rbbp4 PE=2 SV=3 38 210 5.0E-13
sp|O93377|RBP4A_XENLA Histone-binding protein RBBP4-A OS=Xenopus laevis GN=rbbp4-a PE=1 SV=3 38 210 5.0E-13
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 79 214 7.0E-13
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 79 214 7.0E-13
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 79 214 7.0E-13
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 79 214 7.0E-13
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 66 213 7.0E-13
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 79 214 7.0E-13
sp|Q9I8G9|RBBP7_CHICK Histone-binding protein RBBP7 OS=Gallus gallus GN=RBBP7 PE=1 SV=1 34 210 8.0E-13
sp|Q6P315|RBBP7_XENTR Histone-binding protein RBBP7 OS=Xenopus tropicalis GN=rbbp7 PE=2 SV=1 34 210 1.0E-12
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 72 324 1.0E-12
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 97 241 1.0E-12
sp|Q8AVH1|RBBP7_XENLA Histone-binding protein RBBP7 OS=Xenopus laevis GN=rbbp7 PE=2 SV=1 34 210 1.0E-12
sp|Q60973|RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus GN=Rbbp7 PE=1 SV=1 34 210 1.0E-12
sp|Q71UF4|RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus GN=Rbbp7 PE=2 SV=1 34 210 1.0E-12
sp|Q4R304|RBBP7_MACFA Histone-binding protein RBBP7 OS=Macaca fascicularis GN=RBBP7 PE=2 SV=1 34 210 1.0E-12
sp|Q16576|RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens GN=RBBP7 PE=1 SV=1 34 210 1.0E-12
sp|Q3SWX8|RBBP7_BOVIN Histone-binding protein RBBP7 OS=Bos taurus GN=RBBP7 PE=2 SV=1 34 210 1.0E-12
sp|Q5R654|RBBP7_PONAB Histone-binding protein RBBP7 OS=Pongo abelii GN=RBBP7 PE=3 SV=1 34 210 2.0E-12
sp|Q6P3H7|RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio GN=rbbp4 PE=2 SV=3 34 210 2.0E-12
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 77 214 2.0E-12
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 74 208 2.0E-12
sp|Q5RF92|RBBP4_PONAB Histone-binding protein RBBP4 OS=Pongo abelii GN=RBBP4 PE=2 SV=3 38 210 2.0E-12
sp|Q60972|RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus GN=Rbbp4 PE=1 SV=5 38 210 2.0E-12
sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens GN=RBBP4 PE=1 SV=3 38 210 2.0E-12
sp|Q3MHL3|RBBP4_BOVIN Histone-binding protein RBBP4 OS=Bos taurus GN=RBBP4 PE=1 SV=3 38 210 2.0E-12
sp|Q9W7I5|RBBP4_CHICK Histone-binding protein RBBP4 OS=Gallus gallus GN=RBBP4 PE=1 SV=3 38 210 2.0E-12
sp|B2AEZ5|LIS11_PODAN Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 66 213 2.0E-12
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 68 258 2.0E-12
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 77 243 2.0E-12
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 97 241 2.0E-12
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 77 235 2.0E-12
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 77 221 3.0E-12
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 74 222 3.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 80 221 3.0E-12
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 38 220 3.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 74 209 4.0E-12
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 73 255 4.0E-12
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 38 225 5.0E-12
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 38 225 5.0E-12
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 97 253 5.0E-12
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 77 214 5.0E-12
sp|A2QP30|LIS1_ASPNC Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 77 220 5.0E-12
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 74 222 6.0E-12
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 74 222 6.0E-12
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 74 222 6.0E-12
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 74 222 7.0E-12
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 74 222 8.0E-12
sp|A7EKM8|LIS1_SCLS1 Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 77 220 9.0E-12
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 90 253 9.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 74 226 1.0E-11
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 77 228 1.0E-11
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 79 214 1.0E-11
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 77 312 1.0E-11
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 76 226 1.0E-11
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 66 339 2.0E-11
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 34 206 2.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 79 221 2.0E-11
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 66 346 2.0E-11
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 66 223 3.0E-11
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 77 306 3.0E-11
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 74 210 3.0E-11
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 80 265 3.0E-11
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 66 208 3.0E-11
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 66 220 3.0E-11
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 77 312 3.0E-11
sp|Q24572|CAF1_DROME Probable histone-binding protein Caf1 OS=Drosophila melanogaster GN=Caf1 PE=1 SV=1 69 217 3.0E-11
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 66 220 3.0E-11
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 77 207 3.0E-11
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 76 254 3.0E-11
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 74 222 3.0E-11
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 38 213 4.0E-11
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 72 255 4.0E-11
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 74 222 4.0E-11
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 68 211 4.0E-11
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 95 221 4.0E-11
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 48 206 4.0E-11
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 61 261 5.0E-11
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 94 260 5.0E-11
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 35 206 5.0E-11
sp|O94244|HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 76 220 5.0E-11
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 96 244 5.0E-11
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 133 220 5.0E-11
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 66 223 6.0E-11
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 76 210 6.0E-11
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 133 220 6.0E-11
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 76 210 6.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 74 221 6.0E-11
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 77 214 7.0E-11
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 77 208 7.0E-11
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 77 220 7.0E-11
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 79 221 7.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 74 221 7.0E-11
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 71 304 8.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 79 221 8.0E-11
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 79 221 8.0E-11
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 79 221 8.0E-11
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 77 220 9.0E-11
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 38 208 9.0E-11
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 38 208 9.0E-11
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 77 298 9.0E-11
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 50 206 9.0E-11
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 79 221 9.0E-11
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 66 220 1.0E-10
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 66 220 1.0E-10
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 77 220 1.0E-10
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 77 220 1.0E-10
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 66 220 1.0E-10
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 77 298 1.0E-10
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 35 206 1.0E-10
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 66 301 1.0E-10
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 68 211 1.0E-10
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 80 220 1.0E-10
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 77 258 2.0E-10
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 77 261 2.0E-10
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 133 220 2.0E-10
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 69 254 2.0E-10
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 79 222 2.0E-10
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 92 259 2.0E-10
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 74 223 2.0E-10
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 66 220 2.0E-10
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 77 208 2.0E-10
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 133 220 2.0E-10
sp|B6QC06|LIS12_TALMQ Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 77 220 3.0E-10
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 133 220 3.0E-10
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 97 220 3.0E-10
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 79 301 3.0E-10
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 77 261 3.0E-10
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 132 210 3.0E-10
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 66 301 3.0E-10
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 66 301 3.0E-10
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 133 220 4.0E-10
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 133 220 4.0E-10
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 133 220 4.0E-10
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 133 220 4.0E-10
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 77 221 4.0E-10
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 133 220 4.0E-10
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 133 220 4.0E-10
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 133 220 5.0E-10
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 66 216 5.0E-10
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 77 214 5.0E-10
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 133 265 5.0E-10
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 97 253 5.0E-10
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 30 304 5.0E-10
sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 77 254 5.0E-10
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 132 210 5.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 77 314 6.0E-10
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 133 220 6.0E-10
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 97 220 6.0E-10
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 72 226 7.0E-10
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 66 220 7.0E-10
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 66 220 7.0E-10
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 96 228 7.0E-10
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 54 223 7.0E-10
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 36 258 8.0E-10
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 77 208 8.0E-10
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 79 214 9.0E-10
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 133 220 9.0E-10
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 77 220 9.0E-10
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 72 221 9.0E-10
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 50 206 1.0E-09
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 51 208 1.0E-09
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 50 206 1.0E-09
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 72 226 1.0E-09
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 77 274 1.0E-09
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 76 226 1.0E-09
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 30 304 1.0E-09
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 133 210 1.0E-09
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 77 220 1.0E-09
sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 67 210 1.0E-09
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 77 312 1.0E-09
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 72 266 1.0E-09
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 133 265 1.0E-09
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 72 266 1.0E-09
sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 72 221 1.0E-09
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 133 220 1.0E-09
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 77 220 1.0E-09
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 77 226 1.0E-09
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 133 220 1.0E-09
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 77 312 1.0E-09
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 133 261 2.0E-09
sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 79 252 2.0E-09
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 68 220 2.0E-09
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 68 220 2.0E-09
sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 72 221 2.0E-09
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 77 275 2.0E-09
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 54 223 2.0E-09
sp|O22469|MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana GN=MSI3 PE=1 SV=2 69 210 2.0E-09
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 77 220 2.0E-09
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 79 221 2.0E-09
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 77 208 2.0E-09
sp|Q54SD4|RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum GN=rbbD PE=3 SV=1 72 208 2.0E-09
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 133 220 2.0E-09
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 133 220 2.0E-09
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 71 304 2.0E-09
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 96 221 2.0E-09
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 68 258 3.0E-09
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 79 220 3.0E-09
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 68 220 3.0E-09
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 68 220 3.0E-09
sp|C4YPI7|LIS1_CANAW Nuclear distribution protein PAC1 OS=Candida albicans (strain WO-1) GN=PAC1 PE=3 SV=1 96 221 3.0E-09
sp|Q5A7Q6|LIS1_CANAL Nuclear distribution protein PAC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAC1 PE=3 SV=1 96 221 3.0E-09
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 133 220 3.0E-09
sp|O43071|PRP17_SCHPO Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 43 261 3.0E-09
sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 72 221 3.0E-09
sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 72 220 3.0E-09
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 72 222 4.0E-09
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 133 220 4.0E-09
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 77 226 4.0E-09
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 68 220 4.0E-09
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 96 254 4.0E-09
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 83 265 4.0E-09
sp|B9WD30|LIS1_CANDC Nuclear distribution protein PAC1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PAC1 PE=3 SV=1 96 221 4.0E-09
sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 72 220 4.0E-09
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 96 254 4.0E-09
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 77 216 4.0E-09
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 77 216 4.0E-09
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 77 216 4.0E-09
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 133 220 4.0E-09
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 77 216 4.0E-09
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 77 216 4.0E-09
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 133 220 4.0E-09
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 56 221 4.0E-09
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 54 223 4.0E-09
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 133 220 5.0E-09
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 77 216 5.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 79 214 5.0E-09
sp|Q7S7N3|HAT2_NEUCR Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 73 208 5.0E-09
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 56 228 5.0E-09
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 131 265 5.0E-09
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 73 211 5.0E-09
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 77 216 5.0E-09
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 77 216 5.0E-09
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 95 322 5.0E-09
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 133 220 5.0E-09
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 133 220 5.0E-09
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 133 220 5.0E-09
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 77 216 5.0E-09
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 79 221 6.0E-09
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 77 208 6.0E-09
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 64 223 6.0E-09
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 65 226 6.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 133 299 7.0E-09
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 50 220 7.0E-09
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 133 265 7.0E-09
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 65 226 7.0E-09
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 133 220 7.0E-09
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 133 220 7.0E-09
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 133 220 7.0E-09
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 77 251 8.0E-09
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 50 220 8.0E-09
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 50 220 8.0E-09
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 66 228 8.0E-09
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 50 220 8.0E-09
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 50 220 8.0E-09
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 77 216 8.0E-09
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 68 220 8.0E-09
sp|O22469|MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana GN=MSI3 PE=1 SV=2 77 258 8.0E-09
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 76 223 9.0E-09
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 76 226 9.0E-09
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 97 267 9.0E-09
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 79 339 9.0E-09
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 74 221 9.0E-09
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 77 216 9.0E-09
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 77 264 1.0E-08
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 72 225 1.0E-08
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 50 220 1.0E-08
sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 97 264 1.0E-08
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 53 222 1.0E-08
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 76 221 1.0E-08
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 66 220 1.0E-08
sp|B6QC56|LIS11_TALMQ Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 38 208 1.0E-08
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 97 226 1.0E-08
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 74 216 1.0E-08
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 78 206 1.0E-08
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 133 285 1.0E-08
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 133 285 1.0E-08
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 133 285 1.0E-08
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 133 285 1.0E-08
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 133 285 1.0E-08
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 79 221 1.0E-08
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 79 221 1.0E-08
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 96 223 2.0E-08
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 73 275 2.0E-08
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 68 265 2.0E-08
sp|Q10G81|MSI1_ORYSJ Histone-binding protein MSI1 homolog OS=Oryza sativa subsp. japonica GN=MSI1 PE=2 SV=1 62 212 2.0E-08
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 74 207 2.0E-08
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 53 222 2.0E-08
sp|Q5BJ90|WDR12_XENTR Ribosome biogenesis protein wdr12 OS=Xenopus tropicalis GN=wdr12 PE=2 SV=1 129 300 2.0E-08
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 132 254 2.0E-08
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 77 216 2.0E-08
sp|Q9FKT5|THOC3_ARATH THO complex subunit 3 OS=Arabidopsis thaliana GN=THO3 PE=1 SV=1 77 215 2.0E-08
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 53 222 2.0E-08
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 96 220 2.0E-08
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 72 220 2.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 77 221 2.0E-08
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 53 220 2.0E-08
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 133 299 2.0E-08
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 133 220 2.0E-08
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 96 254 2.0E-08
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 79 228 2.0E-08
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 67 220 3.0E-08
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 57 226 3.0E-08
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 77 208 3.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 74 207 3.0E-08
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 96 220 3.0E-08
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 53 220 3.0E-08
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 96 254 3.0E-08
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 80 212 3.0E-08
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 70 208 3.0E-08
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 132 254 3.0E-08
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 53 220 3.0E-08
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 115 220 3.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 79 221 3.0E-08
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 133 299 3.0E-08
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 68 220 3.0E-08
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 74 221 4.0E-08
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 71 220 4.0E-08
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 77 221 4.0E-08
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 77 209 4.0E-08
sp|O22467|MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana GN=MSI1 PE=1 SV=1 67 217 4.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 89 242 4.0E-08
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 133 210 4.0E-08
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 77 225 4.0E-08
sp|Q40687|GBB_ORYSJ Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. japonica GN=RGB1 PE=1 SV=1 77 239 4.0E-08
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 77 210 4.0E-08
sp|B8AP31|GBB_ORYSI Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. indica GN=RGBB PE=2 SV=1 77 239 4.0E-08
sp|P90917|RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1 77 212 4.0E-08
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 79 230 4.0E-08
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 28 223 4.0E-08
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 77 222 4.0E-08
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 68 220 4.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 71 304 5.0E-08
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 77 220 5.0E-08
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 96 254 5.0E-08
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 87 314 5.0E-08
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 76 316 5.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 89 211 5.0E-08
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 77 222 5.0E-08
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 76 223 5.0E-08
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 96 226 6.0E-08
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 97 222 6.0E-08
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 97 222 6.0E-08
sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 90 339 6.0E-08
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 76 223 6.0E-08
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 77 209 6.0E-08
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 77 220 7.0E-08
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 77 230 7.0E-08
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 77 220 7.0E-08
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 97 229 7.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 36 225 7.0E-08
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 77 220 8.0E-08
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 133 211 8.0E-08
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 77 309 8.0E-08
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 77 309 8.0E-08
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 77 230 8.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 76 211 8.0E-08
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 77 220 8.0E-08
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 77 220 8.0E-08
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 77 220 9.0E-08
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 77 312 9.0E-08
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 77 208 9.0E-08
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 96 254 9.0E-08
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 77 230 9.0E-08
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 77 208 9.0E-08
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 77 220 9.0E-08
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 70 226 9.0E-08
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 72 226 9.0E-08
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 77 220 9.0E-08
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 74 220 9.0E-08
sp|O94244|HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 74 210 1.0E-07
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 152 220 1.0E-07
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 55 216 1.0E-07
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 128 226 1.0E-07
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 128 226 1.0E-07
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 128 226 1.0E-07
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 77 220 1.0E-07
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 77 220 1.0E-07
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 77 220 1.0E-07
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 77 220 1.0E-07
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 77 220 1.0E-07
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 96 260 1.0E-07
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 74 216 1.0E-07
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 89 211 1.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 74 216 1.0E-07
sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 80 221 1.0E-07
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 74 299 1.0E-07
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 72 258 1.0E-07
sp|C4JZS6|LIS11_UNCRE Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 77 220 1.0E-07
sp|Q2HJ56|PWP1_BOVIN Periodic tryptophan protein 1 homolog OS=Bos taurus GN=PWP1 PE=2 SV=1 79 221 1.0E-07
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 77 230 1.0E-07
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 133 299 1.0E-07
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 77 208 1.0E-07
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 77 208 1.0E-07
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 79 210 1.0E-07
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 77 208 1.0E-07
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 77 220 1.0E-07
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 79 220 1.0E-07
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 152 220 1.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 79 220 1.0E-07
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 71 220 2.0E-07
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 133 254 2.0E-07
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 96 220 2.0E-07
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 96 220 2.0E-07
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 77 220 2.0E-07
sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 43 166 2.0E-07
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 77 220 2.0E-07
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 77 220 2.0E-07
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 133 210 2.0E-07
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 92 301 2.0E-07
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 53 220 2.0E-07
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 77 258 2.0E-07
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 72 254 2.0E-07
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 92 301 2.0E-07
sp|Q6PFM9|WDR48_DANRE WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 87 268 2.0E-07
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 74 221 2.0E-07
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 93 254 2.0E-07
sp|Q13610|PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens GN=PWP1 PE=1 SV=1 79 221 2.0E-07
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 93 221 2.0E-07
sp|O14021|PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prw1 PE=1 SV=1 79 258 2.0E-07
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 80 264 2.0E-07
sp|C4R6H3|LIS1_PICPG Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 73 222 2.0E-07
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 96 265 2.0E-07
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 77 220 2.0E-07
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 77 220 2.0E-07
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 115 291 2.0E-07
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 56 254 2.0E-07
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 152 220 2.0E-07
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 96 220 3.0E-07
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 96 220 3.0E-07
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 74 216 3.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 74 216 3.0E-07
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 77 220 3.0E-07
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 27 224 3.0E-07
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 93 221 3.0E-07
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 77 208 3.0E-07
sp|Q4R2Z6|WDR48_MACFA WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 87 314 3.0E-07
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 74 220 3.0E-07
sp|Q9W1J3|GAD1_DROME Gastrulation defective protein 1 homolog OS=Drosophila melanogaster GN=CG5543 PE=2 SV=1 78 215 3.0E-07
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 77 230 3.0E-07
sp|O13686|WDR59_SCHPO Uncharacterized RWD, RING finger and WD repeat-containing protein C11E3.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.05 PE=1 SV=1 76 215 3.0E-07
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 77 208 3.0E-07
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 92 217 3.0E-07
sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 128 300 3.0E-07
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 73 275 3.0E-07
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 74 224 3.0E-07
sp|Q54SD4|RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum GN=rbbD PE=3 SV=1 77 257 3.0E-07
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 97 225 3.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 77 208 3.0E-07
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 77 224 3.0E-07
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 77 230 4.0E-07
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 96 220 4.0E-07
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 77 208 4.0E-07
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 133 299 4.0E-07
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 77 309 4.0E-07
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 69 302 4.0E-07
sp|O42937|COPB2_SCHPO Probable coatomer subunit beta' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec27 PE=3 SV=2 130 222 4.0E-07
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 77 221 4.0E-07
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 79 221 4.0E-07
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 53 220 4.0E-07
sp|Q5RAW8|WDR48_PONAB WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 87 314 4.0E-07
sp|Q8TAF3|WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 87 314 4.0E-07
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 76 257 4.0E-07
sp|Q32PG3|WDR48_BOVIN WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 87 314 4.0E-07
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 96 220 4.0E-07
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 56 221 5.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 133 304 5.0E-07
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 77 221 5.0E-07
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 79 210 5.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 95 311 5.0E-07
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 133 210 5.0E-07
sp|Q9USR0|CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckn1 PE=1 SV=1 96 222 5.0E-07
sp|Q7QJ33|WDR12_ANOGA Ribosome biogenesis protein WDR12 homolog OS=Anopheles gambiae GN=AGAP007244 PE=3 SV=3 51 208 5.0E-07
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 22 254 5.0E-07
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 92 301 5.0E-07
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 93 221 5.0E-07
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 77 239 5.0E-07
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 77 268 5.0E-07
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 96 220 6.0E-07
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 77 220 6.0E-07
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 96 220 6.0E-07
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 96 220 6.0E-07
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 96 220 6.0E-07
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 96 220 6.0E-07
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 77 236 6.0E-07
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 90 210 6.0E-07
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 90 210 6.0E-07
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 93 221 6.0E-07
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 93 254 6.0E-07
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 92 301 6.0E-07
sp|Q9JHB4|WDR31_MOUSE WD repeat-containing protein 31 OS=Mus musculus GN=Wdr31 PE=2 SV=1 54 218 6.0E-07
sp|Q8NA23|WDR31_HUMAN WD repeat-containing protein 31 OS=Homo sapiens GN=WDR31 PE=2 SV=1 47 219 6.0E-07
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 152 220 7.0E-07
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 96 220 7.0E-07
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 90 210 7.0E-07
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 90 210 7.0E-07
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 92 301 7.0E-07
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 152 220 8.0E-07
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 77 230 8.0E-07
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 152 220 8.0E-07
sp|O94365|UTP15_SCHPO U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp15 PE=3 SV=1 103 321 8.0E-07
sp|O22466|MSI1_SOLLC WD-40 repeat-containing protein MSI1 OS=Solanum lycopersicum GN=MSI1 PE=2 SV=1 67 208 8.0E-07
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 133 285 8.0E-07
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 64 226 8.0E-07
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 152 220 8.0E-07
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 152 220 8.0E-07
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 96 220 9.0E-07
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 96 220 9.0E-07
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 77 236 9.0E-07
sp|Q5REE6|WDR12_PONAB Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 128 209 9.0E-07
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 152 220 9.0E-07
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 152 220 9.0E-07
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 152 220 9.0E-07
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 152 220 9.0E-07
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 152 220 9.0E-07
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 74 220 1.0E-06
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 48 208 1.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 96 220 1.0E-06
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 77 230 1.0E-06
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 77 230 1.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 77 224 1.0E-06
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 77 236 1.0E-06
sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 83 220 1.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 96 220 1.0E-06
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 89 211 1.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 96 220 1.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 128 226 1.0E-06
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 77 217 1.0E-06
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 71 218 1.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 96 220 1.0E-06
sp|A7MB12|UTP15_BOVIN U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 77 208 1.0E-06
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 76 220 1.0E-06
sp|P38968|SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC31 PE=1 SV=3 53 264 1.0E-06
sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 77 219 1.0E-06
sp|Q6FJ73|CIAO1_CANGA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 136 358 1.0E-06
sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 77 216 1.0E-06
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 97 222 1.0E-06
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 93 220 1.0E-06
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 77 216 1.0E-06
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 77 216 1.0E-06
sp|Q6NNP0|ATG16_ARATH Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 74 241 1.0E-06
sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 128 209 1.0E-06
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 80 255 1.0E-06
sp|Q5AG86|CIAO1_CANAL Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=1 74 212 1.0E-06
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 64 222 1.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 96 220 1.0E-06
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 77 254 1.0E-06
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 72 221 2.0E-06
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 75 210 2.0E-06
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 133 220 2.0E-06
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 76 206 2.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 74 220 2.0E-06
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 74 224 2.0E-06
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 71 218 2.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 74 220 2.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 77 220 2.0E-06
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 96 221 2.0E-06
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 71 218 2.0E-06
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 71 218 2.0E-06
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 70 207 2.0E-06
sp|Q6C7Q4|HAT2_YARLI Histone acetyltransferase type B subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAT2 PE=3 SV=1 80 208 2.0E-06
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 77 207 2.0E-06
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 77 207 2.0E-06
sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 77 216 2.0E-06
sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 117 222 2.0E-06
sp|B0X2V9|WDR48_CULQU WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 97 221 2.0E-06
sp|P61480|WDR12_RAT Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 128 300 2.0E-06
sp|A2RRU3|UTP15_RAT U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 77 208 2.0E-06
sp|Q9JJA4|WDR12_MOUSE Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 128 209 2.0E-06
sp|Q2UF60|SEC31_ASPOR Protein transport protein sec31 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec31 PE=3 SV=2 86 254 2.0E-06
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 74 220 2.0E-06
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 77 211 3.0E-06
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 77 211 3.0E-06
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 53 214 3.0E-06
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 89 254 3.0E-06
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 60 264 3.0E-06
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 79 221 3.0E-06
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 28 224 3.0E-06
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 28 224 3.0E-06
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 28 224 3.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 79 220 3.0E-06
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 28 224 3.0E-06
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 19 167 3.0E-06
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 56 254 3.0E-06
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 90 210 3.0E-06
sp|Q6BIR9|CIAO1_DEBHA Probable cytosolic iron-sulfur protein assembly protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CIA1 PE=3 SV=1 74 233 3.0E-06
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 96 258 3.0E-06
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 79 220 3.0E-06
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 153 220 4.0E-06
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 150 302 4.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 77 224 4.0E-06
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 96 275 4.0E-06
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 150 302 4.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 96 220 4.0E-06
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 79 221 4.0E-06
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 79 221 4.0E-06
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 96 220 4.0E-06
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 70 207 4.0E-06
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 70 207 4.0E-06
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 71 220 4.0E-06
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 70 207 4.0E-06
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 70 207 4.0E-06
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 70 207 4.0E-06
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 70 207 4.0E-06
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 71 220 4.0E-06
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 70 207 4.0E-06
sp|O15736|TIPD_DICDI Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 135 299 4.0E-06
sp|Q2GVT8|SEC31_CHAGB Protein transport protein SEC31 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC31 PE=3 SV=1 80 220 4.0E-06
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 71 207 4.0E-06
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 71 220 4.0E-06
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 71 207 4.0E-06
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 71 220 4.0E-06
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 71 220 4.0E-06
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 150 302 5.0E-06
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 150 302 5.0E-06
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 150 302 5.0E-06
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 150 302 5.0E-06
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 77 206 5.0E-06
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 79 261 5.0E-06
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 96 220 5.0E-06
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 74 221 5.0E-06
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 79 220 5.0E-06
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 76 218 5.0E-06
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 73 221 5.0E-06
sp|B5DG67|WDR12_SALSA Ribosome biogenesis protein wdr12 OS=Salmo salar GN=wdr12 PE=2 SV=1 128 300 5.0E-06
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 70 207 5.0E-06
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 76 218 5.0E-06
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 43 205 5.0E-06
sp|Q96JK2|DCAF5_HUMAN DDB1- and CUL4-associated factor 5 OS=Homo sapiens GN=DCAF5 PE=1 SV=2 80 216 5.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 76 218 5.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 96 220 5.0E-06
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 79 220 6.0E-06
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 79 220 6.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 131 274 6.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 96 220 6.0E-06
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 96 220 6.0E-06
sp|P90917|RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1 79 173 6.0E-06
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 96 220 6.0E-06
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 96 220 6.0E-06
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 96 220 6.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 96 220 6.0E-06
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 77 214 6.0E-06
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 96 220 6.0E-06
sp|Q80T85|DCAF5_MOUSE DDB1- and CUL4-associated factor 5 OS=Mus musculus GN=Dcaf5 PE=1 SV=2 80 216 6.0E-06
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 56 255 6.0E-06
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 69 242 6.0E-06
sp|Q5ZLG9|WDR59_CHICK WD repeat-containing protein 59 OS=Gallus gallus GN=WDR59 PE=2 SV=1 77 210 6.0E-06
sp|P25635|PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 97 214 6.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 74 217 7.0E-06
sp|O22467|MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana GN=MSI1 PE=1 SV=1 36 168 7.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 131 274 7.0E-06
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 97 260 7.0E-06
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 38 168 7.0E-06
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 79 220 7.0E-06
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 79 220 7.0E-06
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 90 210 7.0E-06
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 77 240 7.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 93 220 7.0E-06
sp|B8M0Q1|LIS1_TALSN Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 97 222 7.0E-06
sp|Q03897|WDR59_YEAST Maintenance of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTC5 PE=1 SV=1 84 292 7.0E-06
sp|Q6NX08|WDR12_DANRE Ribosome biogenesis protein wdr12 OS=Danio rerio GN=wdr12 PE=2 SV=1 128 211 7.0E-06
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 77 221 7.0E-06
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 74 237 8.0E-06
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 74 224 8.0E-06
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 74 211 8.0E-06
sp|B8P4B0|LIS11_POSPM Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 96 220 8.0E-06
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 96 220 8.0E-06
sp|O75083|WDR1_HUMAN WD repeat-containing protein 1 OS=Homo sapiens GN=WDR1 PE=1 SV=4 59 305 8.0E-06
sp|Q54SF9|MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 51 218 8.0E-06
sp|B9WHJ2|CIAO1_CANDC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CIA1 PE=3 SV=1 74 165 8.0E-06
sp|Q0VBY8|DDB2_BOVIN DNA damage-binding protein 2 OS=Bos taurus GN=DDB2 PE=2 SV=1 96 210 8.0E-06
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 97 307 8.0E-06
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 72 229 8.0E-06
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 96 253 9.0E-06
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 101 291 9.0E-06
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 71 220 9.0E-06
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 38 168 9.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 53 225 9.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 90 210 9.0E-06
sp|F4ICD9|SC31A_ARATH Protein transport protein SEC31 homolog A OS=Arabidopsis thaliana GN=SEC31A PE=1 SV=1 93 234 1.0E-05
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 133 220 1.0E-05
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 74 221 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 613 632 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2953
MSGRFVRASKYRHVFGKPTRKEFCYDNLHISRNAWDTNLIKVNPSYLSVNWDASGGGAFAVVPLNERGKLPDQIP
LFRGHTAAVLDTDWNPFNDHIIASASDDGKVFLWEVPRDFTLYTDAEEIVDISPVSKLGGHSRKVGQVLFNPSAE
NILASASGDFTIKIWDVGTGQAPHTLKHGDIVQSLSWNAAGSMLVTTSRDKKIRVWDVRQEQPVHEAPGHTGAKN
SRVVWMGEHNRFATTGFSRMSERQIGLWEPGRAEPIGGFSMLDSISGVCIPFWDDGSNCLYLAGKGDGNIRYFEY
ENDKFEFLSEYKSPDPQRGIAFLPRRGINVHENEVMRAYKTVNDSHIEPISFTVPRRAETFQADIFPPAIGIKPA
TGAKEWLDGKTGIPAKIDFESIYDGGAPKEVPSDYKPAPQARSTPPPPPAAKPQPKKEEAAVEEAKPAAAAVRGP
PPTMKEQKGSMSAMANKFQDDDEAAEDDDEISSFEEVSRPTHRPTLPLRSEPKPMVAPPIKSHTEPSPVTTKPSS
PIKTPTAASPMASSNGVESSLDQIKQLIENQTKMITAQNDRIGLLAGEVESLKKKMSSASQDQTERIRQLELELE
EAPETADSGTRSVLFTITAITVIAVIAVIIAIRPVPAADDTLGLADGAATDPLKAAATSRAGLRMRLRISMPPAD
LSLRPVGELTWSGGHFLPPTTHSGLQTVQPPTFSVQPARRAQGWIRAYGSACRGHGAYFSRFRRLVLTSAAGQPP
ARHSGLQTLQPPMFSVQSDRPGR*
Coding >Hirsu2|2953
ATGTCTGGCCGATTCGTGCGGGCGTCGAAATATCGGCACGTCTTTGGCAAGCCGACGCGCAAGGAGTTCTGCTAC
GACAATCTGCACATCAGCCGCAACGCCTGGGACACGAACCTGATCAAGGTCAACCCCTCGTACCTCTCAGTCAAC
TGGGATGCCTCGGGCGGAGGCGCCTTCGCCGTCGTGCCCCTGAACGAGAGGGGCAAGCTGCCCGACCAGATCCCG
CTGTTCCGCGGCCACACCGCCGCCGTGCTCGACACCGACTGGAACCCGTTCAACGACCACATCATCGCCTCCGCC
TCCGACGACGGCAAGGTCTTCCTCTGGGAGGTGCCGCGGGACTTTACCCTCTATACCGACGCCGAGGAGATTGTC
GACATATCGCCCGTCAGCAAGTTGGGCGGTCATTCCAGAAAGGTCGGGCAGGTCCTCTTCAACCCCTCGGCCGAG
AACATCCTCGCCTCCGCTTCTGGCGACTTCACCATCAAGATCTGGGACGTTGGCACCGGGCAGGCCCCGCACACC
CTCAAGCATGGCGACATCGTCCAGAGCCTGTCGTGGAACGCGGCCGGCAGCATGCTCGTCACGACGTCGCGCGAC
AAGAAGATCCGCGTCTGGGACGTCCGTCAAGAGCAGCCCGTGCATGAGGCGCCGGGCCACACCGGGGCCAAGAAC
AGCAGGGTCGTGTGGATGGGCGAGCACAACCGCTTCGCCACCACCGGCTTCTCCAGGATGAGCGAGCGTCAGATC
GGCCTGTGGGAGCCCGGGAGAGCGGAGCCCATCGGCGGCTTCTCCATGCTCGACTCCATCTCGGGCGTCTGCATC
CCGTTCTGGGACGACGGCTCCAACTGCCTCTACCTCGCCGGCAAGGGCGACGGCAACATCCGCTACTTCGAGTAC
GAGAACGACAAGTTCGAGTTCCTCAGCGAGTACAAGTCTCCCGATCCCCAGCGAGGCATCGCCTTCCTCCCGAGG
CGCGGCATCAATGTGCACGAGAACGAGGTGATGCGGGCGTACAAGACGGTCAACGACAGCCACATAGAGCCCATC
TCCTTCACCGTGCCTCGACGCGCCGAGACCTTCCAGGCCGACATCTTCCCGCCGGCCATTGGCATCAAACCAGCC
ACCGGCGCCAAGGAATGGCTCGACGGCAAGACCGGGATCCCGGCCAAGATCGACTTCGAGAGCATCTACGACGGC
GGCGCGCCCAAGGAGGTGCCGTCAGACTACAAGCCGGCCCCTCAGGCCCGGTCCACGCCGCCGCCGCCGCCGGCC
GCCAAGCCGCAGCCCAAGAAGGAAGAGGCGGCTGTGGAGGAGGCCAAGCCTGCGGCGGCGGCCGTCCGAGGCCCT
CCCCCGACCATGAAGGAGCAGAAGGGATCCATGTCTGCCATGGCGAACAAGTTCCAGGATGACGACGAGGCGGCC
GAGGATGACGACGAGATTTCCAGCTTCGAGGAAGTCTCTCGACCGACGCACCGACCCACCCTGCCCCTTCGCTCG
GAACCCAAGCCGATGGTGGCGCCGCCGATCAAGAGCCACACAGAGCCGTCGCCGGTGACGACGAAGCCGTCGTCT
CCCATCAAGACGCCCACGGCCGCATCCCCGATGGCTTCATCCAACGGCGTCGAGTCGTCGCTCGACCAGATCAAG
CAGCTGATTGAGAACCAGACCAAGATGATCACGGCGCAGAACGACAGGATCGGTCTGCTGGCCGGCGAGGTCGAG
TCGCTGAAGAAGAAGATGAGCTCGGCCAGCCAGGACCAGACGGAGCGCATCAGGCAGCTGGAGCTGGAGCTGGAG
GAGGCGCCGGAGACGGCCGACTCCGGGACGCGATCAGTACTCTTCACCATCACCGCCATTACCGTCATCGCCGTC
ATCGCCGTCATCATCGCCATCCGACCCGTTCCCGCCGCCGACGACACACTCGGGCTTGCAGACGGTGCAGCCACG
GACCCTCTCAAGGCAGCCGCCACGTCGCGAGCAGGCCTAAGGATGCGGCTCCGGATCAGCATGCCGCCCGCCGAC
TTGTCGCTTCGTCCTGTCGGGGAGCTTACCTGGAGCGGCGGACACTTCCTGCCGCCGACGACGCACTCGGGCTTG
CAGACGGTGCAGCCGCCGACATTCTCGGTGCAGCCGGCGCGGCGGGCGCAGGGCTGGATCCGGGCATACGGGTCA
GCGTGCCGCGGACACGGGGCCTACTTCTCGCGGTTCCGTCGCCTCGTGCTTACCTCGGCCGCCGGGCAGCCGCCG
GCCCGGCACTCGGGCTTGCAGACGCTGCAGCCGCCGATGTTCTCGGTGCAGTCGGACCGCCCGGGTAGATGA
Transcript >Hirsu2|2953
ATGTCTGGCCGATTCGTGCGGGCGTCGAAATATCGGCACGTCTTTGGCAAGCCGACGCGCAAGGAGTTCTGCTAC
GACAATCTGCACATCAGCCGCAACGCCTGGGACACGAACCTGATCAAGGTCAACCCCTCGTACCTCTCAGTCAAC
TGGGATGCCTCGGGCGGAGGCGCCTTCGCCGTCGTGCCCCTGAACGAGAGGGGCAAGCTGCCCGACCAGATCCCG
CTGTTCCGCGGCCACACCGCCGCCGTGCTCGACACCGACTGGAACCCGTTCAACGACCACATCATCGCCTCCGCC
TCCGACGACGGCAAGGTCTTCCTCTGGGAGGTGCCGCGGGACTTTACCCTCTATACCGACGCCGAGGAGATTGTC
GACATATCGCCCGTCAGCAAGTTGGGCGGTCATTCCAGAAAGGTCGGGCAGGTCCTCTTCAACCCCTCGGCCGAG
AACATCCTCGCCTCCGCTTCTGGCGACTTCACCATCAAGATCTGGGACGTTGGCACCGGGCAGGCCCCGCACACC
CTCAAGCATGGCGACATCGTCCAGAGCCTGTCGTGGAACGCGGCCGGCAGCATGCTCGTCACGACGTCGCGCGAC
AAGAAGATCCGCGTCTGGGACGTCCGTCAAGAGCAGCCCGTGCATGAGGCGCCGGGCCACACCGGGGCCAAGAAC
AGCAGGGTCGTGTGGATGGGCGAGCACAACCGCTTCGCCACCACCGGCTTCTCCAGGATGAGCGAGCGTCAGATC
GGCCTGTGGGAGCCCGGGAGAGCGGAGCCCATCGGCGGCTTCTCCATGCTCGACTCCATCTCGGGCGTCTGCATC
CCGTTCTGGGACGACGGCTCCAACTGCCTCTACCTCGCCGGCAAGGGCGACGGCAACATCCGCTACTTCGAGTAC
GAGAACGACAAGTTCGAGTTCCTCAGCGAGTACAAGTCTCCCGATCCCCAGCGAGGCATCGCCTTCCTCCCGAGG
CGCGGCATCAATGTGCACGAGAACGAGGTGATGCGGGCGTACAAGACGGTCAACGACAGCCACATAGAGCCCATC
TCCTTCACCGTGCCTCGACGCGCCGAGACCTTCCAGGCCGACATCTTCCCGCCGGCCATTGGCATCAAACCAGCC
ACCGGCGCCAAGGAATGGCTCGACGGCAAGACCGGGATCCCGGCCAAGATCGACTTCGAGAGCATCTACGACGGC
GGCGCGCCCAAGGAGGTGCCGTCAGACTACAAGCCGGCCCCTCAGGCCCGGTCCACGCCGCCGCCGCCGCCGGCC
GCCAAGCCGCAGCCCAAGAAGGAAGAGGCGGCTGTGGAGGAGGCCAAGCCTGCGGCGGCGGCCGTCCGAGGCCCT
CCCCCGACCATGAAGGAGCAGAAGGGATCCATGTCTGCCATGGCGAACAAGTTCCAGGATGACGACGAGGCGGCC
GAGGATGACGACGAGATTTCCAGCTTCGAGGAAGTCTCTCGACCGACGCACCGACCCACCCTGCCCCTTCGCTCG
GAACCCAAGCCGATGGTGGCGCCGCCGATCAAGAGCCACACAGAGCCGTCGCCGGTGACGACGAAGCCGTCGTCT
CCCATCAAGACGCCCACGGCCGCATCCCCGATGGCTTCATCCAACGGCGTCGAGTCGTCGCTCGACCAGATCAAG
CAGCTGATTGAGAACCAGACCAAGATGATCACGGCGCAGAACGACAGGATCGGTCTGCTGGCCGGCGAGGTCGAG
TCGCTGAAGAAGAAGATGAGCTCGGCCAGCCAGGACCAGACGGAGCGCATCAGGCAGCTGGAGCTGGAGCTGGAG
GAGGCGCCGGAGACGGCCGACTCCGGGACGCGATCAGTACTCTTCACCATCACCGCCATTACCGTCATCGCCGTC
ATCGCCGTCATCATCGCCATCCGACCCGTTCCCGCCGCCGACGACACACTCGGGCTTGCAGACGGTGCAGCCACG
GACCCTCTCAAGGCAGCCGCCACGTCGCGAGCAGGCCTAAGGATGCGGCTCCGGATCAGCATGCCGCCCGCCGAC
TTGTCGCTTCGTCCTGTCGGGGAGCTTACCTGGAGCGGCGGACACTTCCTGCCGCCGACGACGCACTCGGGCTTG
CAGACGGTGCAGCCGCCGACATTCTCGGTGCAGCCGGCGCGGCGGGCGCAGGGCTGGATCCGGGCATACGGGTCA
GCGTGCCGCGGACACGGGGCCTACTTCTCGCGGTTCCGTCGCCTCGTGCTTACCTCGGCCGCCGGGCAGCCGCCG
GCCCGGCACTCGGGCTTGCAGACGCTGCAGCCGCCGATGTTCTCGGTGCAGTCGGACCGCCCGGGTAGATGA
Gene >Hirsu2|2953
ATGTCTGGCCGATTCGTGCGGGCGTCGAAATATCGTGAGTGCACTTGGCCCCGAGAGCTGGCCTGGTCGGGTGGA
GCCGGCGGTTGACTGATGGGCCGCCGATCGACAGGGCACGTCTTTGGCAAGCCGACGCGCAAGGAGTTCTGCTAC
GACAATCTGCACATCAGCCGCAACGCCTGGGACACGAACCTGATCAAGGTGCCCGCCGACCGCCGCCGGACCCTC
CTCCCCCGTTGCCCGCTCGCGGCCGAACCCGGAGTGCTGACGTCGAGCCCTGCGTCAAGGTCAACCCCTCGTACC
TCTCAGTCAACTGGGATGCCTCGGGCGGAGGCGCCTTCGCCGTCGTGCCCCTGAACGAGAGGGGCAAGCTGCCCG
ACCAGATCCCGCTGTTCCGCGGCCACACCGCCGCCGTGCTCGACACCGACTGGTGCGTTTGGATTTGCCGCCTCT
TCCGGGCTCGCCGCCGTCGTTCCCGTCCCTCGGCTGACCTGGCCCGCAGGAACCCGTTCAACGACCACATCATCG
CCTCCGCCTCCGACGACGGCAAGGTCTTCCTCTGGGAGGTGCCGCGGGACTTTACCCTCTATACCGACGCCGAGG
AGATTGTCGACATATCGCCCGTCAGCAAGTTGGGCGGTCATTCCAGGTGCGTTGTCGCGCCCTTCACCCCAGACG
GAACCCCTCTTCATCCGGTGCTGACCGGGTGCTGCACGCCCTGCAAAATAGAAAGGTCGGGCAGGTCCTCTTCAA
CCCCTCGGCCGAGAACATCCTCGCCTCCGCTTCTGGCGACTTCACCATCAAGATCTGGGACGTTGGCACCGGGCA
GGCCCCGCACACCCTCAAGCATGGCGACATCGTCCAGAGCCTGTCGTGGAACGCGGCCGGCAGCATGCTCGTCAC
GACGTCGCGCGACAAGAAGATCCGCGTCTGGGACGTCCGTCAAGAGCAGCCCGTGCATGAGGCGCCGGGCCACAC
CGGGGCCAAGAACAGCAGGGTCGTGTGGATGGGCGAGCACAACCGCTTCGCCACCACCGGCTTCTCCAGGATGAG
CGAGCGTCAGATCGGCCTGTGGGAGCCCGGGAGAGCGGAGCCCATCGGCGGCTTCTCCATGCTCGACTCCATCTC
GGGCGTCTGCATCCCGTTCTGGGGTACGTGCCGGCCCTGACACGGGGCCGTTACGAAGCGGTAGTGCCGGATGCT
GACGGGCGCATAGACGACGGCTCCAACTGCCTCTACCTCGCCGGCAAGGGGTGAGTGAAGCAAGAACCCCCATCC
GCGCGGCGCGCGTCTGCTGACGATAAGGGCAAGCGACGGCAACATCCGCTACTTCGAGTACGAGAACGACAAGTT
CGAGTTCCTCAGCGAGTACAAGTCTCCCGATCCCCAGCGAGGCATCGCCTTCCTCCCGAGGCGCGGCATCAATGT
GAGCCGTGCAGCGCCCCCGCTCACCGCCGGGGCTGGGCTGACAGTAGCCAGGTGCACGAGAACGAGGTGATGCGG
GCGTACAAGACGGTCAACGACAGCCACATAGAGCCCATCTCCTTCACCGTGCCTCGACGCGCCGAGACCTTCCAG
GCCGACATCTTCCCGCCGGCCATTGGCATCAAACCAGCCACCGGCGCCAAGGAATGGCTCGACGGCAAGACCGGG
ATCCCGGCCAAGATCGACTTCGAGAGCATCTACGACGGCGGCGCGCCCAAGGAGGTGCCGTCAGACTACAAGCCG
GCCCCTCAGGCCCGGTCCACGCCGCCGCCGCCGCCGGCCGCCAAGCCGCAGCCCAAGAAGGAAGAGGCGGCTGTG
GAGGAGGCCAAGCCTGCGGCGGCGGCCGTCCGAGGCCCTCCCCCGACCATGAAGGAGCAGAAGGGATCCATGTCT
GCCATGGCGAACAAGTTCCAGGATGACGACGAGGCGGCCGAGGATGACGACGAGATTTCCAGCTTCGAGGAAGTC
TCTCGACCGACGCACCGACCCACCCTGCCCCTTCGCTCGGAACCCAAGCCGATGGTGGCGCCGCCGATCAAGAGC
CACACAGAGCCGTCGCCGGTGACGACGAAGCCGTCGTCTCCCATCAAGACGCCCACGGCCGCATCCCCGATGGCT
TCATCCAACGGCGTCGAGTCGTCGCTCGACCAGATCAAGCAGCTGATTGAGAACCAGACCAAGATGATCACGGCG
CAGAACGACAGGATCGGTCTGCTGGCCGGCGAGGTCGAGTCGCTGAAGAAGAAGATGAGCTCGGCCAGCCAGGAC
CAGACGGAGCGCATCAGGCAGCTGGAGCTGGAGCTGGAGGAGGCGCGTTCGTGATGGTCAACGACGGCGACGGCG
GCGAGAGGAGTTCAGGCACCAGGTCTACAACGTCTTGGAAACGGAACGGATTGCGACGGCCGGCTGCGCATGGGC
ATCGGCAGCGAGGCGGCTGTGGCGAGCAACCGGGGGCCGAGGCCGTGGGGACTTTTTGGTCCGGTGCCGGCCGGC
CCCCGACTCGGCATTGAGCTCGGTGTTATCGATTCTTGGCTGAATACCTAGGTTTCCACTGTCCCTGTTCCTTGC
TGTCCCACCGCGACGGCTGTGCCGTAGCGTTGACTTGCCAATGGAGATCAAGAGACTCTGGGGCCCATATCTTGC
TGTGGCTTTGCACGTGAGTGACTATCGTCTCGATCTAGAAAACCAGAGCTGGGACCCACAGCTGTAGCTTGCTAT
CTGGGGCCCGTCACATGACCGCCATCGCACCTTCAGGCAGACAAGCCTCGTATCCAAAGCTTGGCTAGACGACCC
GCATCCATATTGGTTACGCAGAGGACCCGTAAGGCGACTGAGGAAGATACGCCGAGTGGACGAGACTAATGAGAC
ATGCACCATGACCACGATCAGGAGAGCAGAGTCTTGGGGCGCTTGGGTCATGCTCGCCACACAGGGCAGCTCTCT
CTCTCCGCAACATTGTCAATCCCCGGAAGAGCAACGAAGAGACTTGCGATGTCATGATGCCACTGGACGCCCCTA
GAGGCGGTGAGGAGGCAAAGTAGGCCGACGAGGTACAGACGAGCCGCCGAGTGCTTCCAGACCATTTCAACGGCA
TCGCCGACCTCCCGCACGAGCCCGGAACGACGGCCGTCCCCAGCGGAGACGGCCGACTCCGGGACGCGATCAGTA
CTCTTCACCATCACCGCCATTACCGTCATCGCCGTCATCGCCGTCATCATCGCCATCCGACCCGTTCCCGCCGCC
GACGACACACTCGGGCTTGCAGACGGTGCAGCCACGGACCCTCTCAAGGCAGCCGCCACGTCGCGAGCAGGCCTA
AGGATGCGGCTCCGGATCAGCATGCCGCCCGCCGACTTGTCGCTTCGTCCTGTCGGGGAGCTTACCTGGAGCGGC
GGACACTTCCTGCCGCCGACGACGCACTCGGGCTTGCAGACGGTGCAGCCGCCGACATTCTCGGTGCAGCCGGCG
CGGCGGGCGCAGGGCTGGATCCGGGCATACGGGTCAGCGTGCCGCGGACACGGGGCCTACTTCTCGCGGTTCCGT
CGCCTCGTGCTTACCTCGGCCGCCGGGCAGCCGCCGGCCCGGCACTCGGGCTTGCAGACGCTGCAGCCGCCGATG
TTCTCGGTGCAGTCGGACCGTAGGAGACAGGGCTGTGTTCAATGCTCCGAATCAGCGCGCGGGCTCGCCGGCGGA
GAGATACGGCTCTCGCCCGACCCGGGTCGTTCTTTCGGCTTACCCCCGGGGCCACGCACGAGGCCCCGTCAAGGC
CCGGGTAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail