Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2949
Gene name
LocationContig_174:14737..15754
Strand+
Gene length (bp)1017
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 8.1E-11 41 192
PF07714 Pkinase_Tyr Protein tyrosine kinase 9.6E-09 38 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 74 189 1.0E-08
sp|Q9SV83|Y4103_ARATH Probable receptor-like protein kinase At4g10390 OS=Arabidopsis thaliana GN=At4g10390 PE=2 SV=1 38 139 1.0E-07
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 23 189 2.0E-07
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 37 185 7.0E-07
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 37 185 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 74 189 1.0E-08
sp|Q9SV83|Y4103_ARATH Probable receptor-like protein kinase At4g10390 OS=Arabidopsis thaliana GN=At4g10390 PE=2 SV=1 38 139 1.0E-07
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 23 189 2.0E-07
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 37 185 7.0E-07
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 37 185 2.0E-06
sp|B1WBU5|SBK2_RAT Serine/threonine-protein kinase SBK2 OS=Rattus norvegicus GN=Sbk2 PE=2 SV=1 48 189 3.0E-06
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 74 212 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2949
MENVGPTSTIESIRPGVVLKQPIIFQSEGFAEKVDLCFSVEPLILQQLGQHPRMVRYLGQQGRALLLGQASHSNL
QAYIDSNSSIDLRQRVLWCRQLAEAISHVHSHGVAHSDLRPRKVLVHESIPGSLDLLLCDFGGSTCDELGLDGHG
GCLPDGPFYHPAFDCKSTPALDIFGLASFFYTVLTGRWPARSTPGAPQSIDENYANEKEVAEAFSQGSYPDLKCL
GGVVPMSSGWKKVGFIQPSGGILARGPESG*
Coding >Hirsu2|2949
ATGGAAAACGTCGGACCCACGAGCACTATCGAATCAATCCGGCCTGGAGTCGTTCTCAAGCAGCCCATAATCTTC
CAGTCGGAAGGATTTGCCGAGAAGGTCGATCTCTGCTTTTCTGTCGAGCCGCTCATACTCCAGCAACTTGGGCAG
CATCCAAGGATGGTGAGGTATCTCGGCCAGCAAGGCCGCGCTTTGTTACTCGGTCAGGCTAGCCACAGCAATCTT
CAAGCCTATATCGACAGCAATTCTTCGATCGACTTGCGCCAACGCGTGCTCTGGTGTCGACAATTGGCCGAAGCC
ATCTCCCATGTTCACAGCCATGGCGTGGCCCACTCTGATCTTCGTCCCAGAAAAGTTCTCGTTCACGAAAGTATC
CCGGGATCCCTGGACTTATTGCTCTGTGACTTTGGTGGATCTACATGTGACGAACTTGGGCTGGATGGACATGGA
GGCTGCCTCCCCGATGGCCCTTTCTACCACCCCGCCTTTGATTGCAAGTCAACTCCAGCTCTCGACATATTCGGC
CTTGCATCTTTCTTCTACACCGTATTGACTGGTCGTTGGCCTGCTAGATCGACTCCTGGGGCGCCGCAATCCATA
GATGAGAATTATGCCAACGAAAAAGAAGTCGCTGAGGCTTTCAGCCAGGGAAGTTATCCTGATTTGAAGTGCTTG
GGAGGGGTAGTTCCGATGAGCAGCGGCTGGAAAAAAGTGGGCTTTATCCAGCCATCAGGCGGCATTTTGGCGAGA
GGCCCTGAGTCTGGGTAG
Transcript >Hirsu2|2949
ATGGAAAACGTCGGACCCACGAGCACTATCGAATCAATCCGGCCTGGAGTCGTTCTCAAGCAGCCCATAATCTTC
CAGTCGGAAGGATTTGCCGAGAAGGTCGATCTCTGCTTTTCTGTCGAGCCGCTCATACTCCAGCAACTTGGGCAG
CATCCAAGGATGGTGAGGTATCTCGGCCAGCAAGGCCGCGCTTTGTTACTCGGTCAGGCTAGCCACAGCAATCTT
CAAGCCTATATCGACAGCAATTCTTCGATCGACTTGCGCCAACGCGTGCTCTGGTGTCGACAATTGGCCGAAGCC
ATCTCCCATGTTCACAGCCATGGCGTGGCCCACTCTGATCTTCGTCCCAGAAAAGTTCTCGTTCACGAAAGTATC
CCGGGATCCCTGGACTTATTGCTCTGTGACTTTGGTGGATCTACATGTGACGAACTTGGGCTGGATGGACATGGA
GGCTGCCTCCCCGATGGCCCTTTCTACCACCCCGCCTTTGATTGCAAGTCAACTCCAGCTCTCGACATATTCGGC
CTTGCATCTTTCTTCTACACCGTATTGACTGGTCGTTGGCCTGCTAGATCGACTCCTGGGGCGCCGCAATCCATA
GATGAGAATTATGCCAACGAAAAAGAAGTCGCTGAGGCTTTCAGCCAGGGAAGTTATCCTGATTTGAAGTGCTTG
GGAGGGGTAGTTCCGATGAGCAGCGGCTGGAAAAAAGTGGGCTTTATCCAGCCATCAGGCGGCATTTTGGCGAGA
GGCCCTGAGTCTGGGTAG
Gene >Hirsu2|2949
ATGGAAAACGTCGGACCCACGAGCACTATCGAATCAATCCGGCCTGGAGTCGTTCTCAAGCAGCCCATAATCTTC
CAGTCGGAAGGATTTGCCGAGAAGGTCGATCTCTGCTTTTCTGTCGAGCCGCTCATACTCCAGCAACTTGGGCAG
CATCCAAGGATGGTGAGGTAAGGGCATCGGGTATGGCTGTGATCGCCAGTGCACACTTATGGCATCTCACTCTTA
GGTATCTCGGCCAGCAAGGCCGCGCTTTGTTACTCGGTCAGGCTAGCCACAGCAATCTTCAAGCCTATATCGACA
GCAATTCTTCGATCGACTTGCGCCAACGCGTGCTCTGGTGTCGACAATTGGCCGAAGCCATCTCCCATGTTCACA
GCCATGGCGTGGCCCACTCTGATCTTCGTCCCAGAAAAGTTCTCGTTCACGAAAGTATCCCGGGATCCCTGGACT
TATTGCTCTGTGACTTTGGTGGATCTACATGTGACGAACTTGGGCTGGATGGACATGGAGGCTGCCTCCCCGATG
GCCCTTTCTACCACCCCGCCTTTGATTGCAAGTCAACTCCAGCTCTCGACATATTCGGCCTTGCATCTTTCTTCT
ACACCGTATTGACTGGTCGTTGGCCTGCTAGATCGACTCCTGGGGCGCCGCAATCCATAGATGAGAATTATGCCA
ACGAAAAAGAAGTCGCTGAGGCTTTCAGCCAGGGAAGTTATCCTGATTTGAAGTGCTTGGGAGGGGTAGGTGAGA
TTCTTTCCTGTGCATGAAGCGGTACGGGACAGCTGAGAAAGTCTTGCGCGCTTTAGAAAGGGAAATGCAGATTCC
TAAGGCAGAGACAGATCCGGAAGCGGCTCACTGTATCCCAGTACTCTTTGGAATGGCAATGTCTGTTGCTGCTTC
GGCAACTCTGACATACATACTGATCCAGAGATAGTTCCGATGAGCAGCGGCTGGAAAAAAGTGGGCTTTATCCAG
CCATCAGGCGGCATTTTGGCGAGAGGCCCTGAGTCTGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail