Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2943
Gene name
LocationContig_1738:178..734
Strand-
Gene length (bp)556
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 2.0E-13 45 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40557|EPS1_YEAST ER-retained PMA1-suppressing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPS1 PE=1 SV=1 41 132 3.0E-09
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 1 136 3.0E-08
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 44 136 6.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 46 136 1.0E-06
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 46 136 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40557|EPS1_YEAST ER-retained PMA1-suppressing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPS1 PE=1 SV=1 41 132 3.0E-09
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 1 136 3.0E-08
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 44 136 6.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 46 136 1.0E-06
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 46 136 2.0E-06
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 23 137 3.0E-06
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 23 137 3.0E-06
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 46 136 3.0E-06
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 46 136 3.0E-06
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 46 132 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2943
MRLNLLALVVALAARAWAESDEEEEREPEPQPTIFNSVTVPPPFELTPTNWEHEVKKTKWLIVKHYSPYCPHCID
FLPVYQTAYEFYHTSKSPDGKPFADEYDFRFAVINCVAHSEFCEDHNVKSWPTTVIYKDGERR*
Coding >Hirsu2|2943
ATGAGGCTGAACTTGTTGGCCCTCGTCGTCGCCCTCGCCGCCCGCGCCTGGGCCGAGTCGGACGAGGAAGAAGAG
CGCGAACCCGAGCCGCAGCCGACCATCTTCAACTCCGTCACCGTCCCTCCCCCCTTTGAGCTCACGCCCACCAAC
TGGGAGCACGAGGTCAAGAAGACGAAGTGGCTGATCGTCAAGCACTACAGCCCCTATTGCCCTCACTGCATCGAC
TTCCTCCCCGTCTACCAGACCGCATACGAGTTCTATCACACCTCCAAGTCGCCCGACGGCAAGCCCTTCGCCGAC
GAGTACGACTTCCGTTTCGCCGTCATCAACTGCGTCGCCCACTCCGAATTCTGCGAAGACCATAATGTCAAGTCG
TGGCCGACCACCGTCATCTACAAAGACGGAGAGAGGCGCTAG
Transcript >Hirsu2|2943
ATGAGGCTGAACTTGTTGGCCCTCGTCGTCGCCCTCGCCGCCCGCGCCTGGGCCGAGTCGGACGAGGAAGAAGAG
CGCGAACCCGAGCCGCAGCCGACCATCTTCAACTCCGTCACCGTCCCTCCCCCCTTTGAGCTCACGCCCACCAAC
TGGGAGCACGAGGTCAAGAAGACGAAGTGGCTGATCGTCAAGCACTACAGCCCCTATTGCCCTCACTGCATCGAC
TTCCTCCCCGTCTACCAGACCGCATACGAGTTCTATCACACCTCCAAGTCGCCCGACGGCAAGCCCTTCGCCGAC
GAGTACGACTTCCGTTTCGCCGTCATCAACTGCGTCGCCCACTCCGAATTCTGCGAAGACCATAATGTCAAGTCG
TGGCCGACCACCGTCATCTACAAAGACGGAGAGAGGCGCTAG
Gene >Hirsu2|2943
ATGAGGCTGAACTTGTTGGCCCTCGTCGTCGCCCTCGCCGCCCGCGCCTGGGCCGAGTCGGACGAGGAAGAAGAG
CGCGAACCCGAGCCGCAGCCGACCATCTTCAACTCCGTCACCGTCCCTCCCCCCTTTGAGCTCACGCCCACCAAC
TGGGAGCACGAGGTCAAGAAGACGAAGTGGCTGATCGTCAAGCACTACAGGTACGCGCCCCTGACTCCCTCCCTA
CCTCTCCTCATGCGCCGCGCCGCCCGCACATACTGACGTCCGACGACGCTCCGCAGCCCCTATTGCCCTCACTGC
ATCGACTTCCTCCCCGTCTACCAGACCGCATACGAGTTCTATCACACCTCCAAGTCGCCCGACGGCAAGCCCTTC
GCCGACGAGTACGACTTCCGTTTCGCCGTCATCAACTGCGTCGCCCACTCCGAATTCTGCGAAGACCATAATGTC
AAGTCGTGGCCGACCACCGTCATCTACAAAGACGGAGAGGTCTTCAAGTCGCTCAAGGGCAACCGGGACATGTCC
AAGCTCAGCGCCTTCATCGAAGAGGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail