Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2941
Gene name
LocationContig_1735:2680..4515
Strand+
Gene length (bp)1835
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04050 Upf2 Up-frameshift suppressor 2 3.1E-40 321 442
PF02854 MIF4G MIF4G domain 7.1E-29 29 233

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|F4IUX6|RENT2_ARATH Regulator of nonsense transcripts UPF2 OS=Arabidopsis thaliana GN=UPF2 PE=2 SV=1 2 453 1.0E-78
sp|Q9HAU5|RENT2_HUMAN Regulator of nonsense transcripts 2 OS=Homo sapiens GN=UPF2 PE=1 SV=1 2 250 2.0E-58
sp|O13824|NMD2_SCHPO Nonsense-mediated mRNA decay protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf2 PE=1 SV=1 1 444 4.0E-50
sp|P38798|NMD2_YEAST Nonsense-mediated mRNA decay protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD2 PE=1 SV=2 3 274 3.0E-39

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2941
MLIDNAVYYVDPPERPAIERKERTPMELFVRKLVYSDLTKKNYGKILKQIRRFHWEEADVVFILEKVFSKPGKVK
YGNIHLLGILLSALNRYHSEFVVKVIDNVIESVCVGLEQNDFRFFQRRIAEVKYLGELYNYRMLEHPVIFDSMYK
IMTFGYGGPPVPGRLNPFDPPDDFFRIRLIATVLETCGVFFNRGVAGKKLDYFLAFFQYYVHTKSSLPMEMEFIV
QDIFALTRPQWKLASTLEEATKAFQLAIAQDQKTSGADRALEPDEATSVASSEDENGDVDDIEPYGDGEDETASE
DDEAEQDDEDDSAHESDFNDETLVVTRQEETIDPYDEAEFEREYARMMSESLESRKFERKQLFDVPLPVRPKNRD
VAALTAQGDDSNATSNTMAFSLLTRRGNRQQTRTVELPSDSTFAIAMKTQQQAEREEQQRIKNLVLNYDLQHSED
QEGHDRLPTFHHNRTDRTGKDRGQRVRKLQLSDVDW*
Coding >Hirsu2|2941
ATGCTCATCGACAACGCAGTTTACTATGTCGACCCGCCTGAGCGACCCGCCATTGAACGGAAGGAACGAACTCCC
ATGGAGCTCTTTGTCCGTAAACTCGTTTACAGTGATTTGACCAAGAAGAATTACGGGAAGATTTTGAAGCAGATT
CGTAGGTTTCATTGGGAGGAAGCGGATGTTGTCTTCATTCTGGAAAAAGTCTTCTCCAAACCTGGGAAAGTCAAG
TATGGAAACATTCATCTTCTCGGGATTCTATTAAGTGCTTTGAATCGCTACCACTCAGAATTTGTCGTCAAGGTG
ATCGACAATGTCATTGAGTCTGTGTGCGTTGGTTTAGAGCAGAACGATTTCAGGTTTTTTCAACGTCGCATAGCA
GAAGTTAAGTACTTAGGCGAACTCTACAACTATCGGATGTTGGAGCATCCTGTCATTTTCGACAGCATGTACAAA
ATTATGACTTTTGGATACGGCGGTCCGCCGGTCCCTGGACGGTTGAACCCTTTCGATCCGCCAGATGACTTCTTT
CGCATCCGTCTGATCGCTACAGTCCTGGAAACGTGCGGCGTATTTTTCAACAGAGGAGTCGCAGGTAAGAAACTG
GACTACTTCCTGGCTTTCTTTCAGTACTACGTTCACACAAAGTCGTCCCTACCAATGGAAATGGAGTTCATCGTT
CAGGACATTTTCGCCCTTACCCGACCGCAGTGGAAGCTCGCCTCTACCCTAGAGGAAGCAACAAAAGCGTTCCAA
CTGGCCATAGCACAGGATCAAAAGACTTCAGGAGCTGATAGGGCCCTTGAACCAGATGAGGCCACGAGTGTTGCG
TCGTCTGAAGATGAGAACGGAGACGTTGACGACATCGAGCCGTATGGCGATGGTGAGGATGAGACTGCCTCGGAA
GATGACGAAGCCGAGCAGGATGATGAGGATGATTCAGCTCACGAAAGCGACTTCAACGATGAGACGCTAGTCGTG
ACCCGTCAAGAGGAAACGATCGACCCCTATGACGAGGCTGAGTTCGAACGAGAGTATGCGAGAATGATGTCTGAG
AGCTTGGAATCTCGGAAGTTTGAGCGCAAGCAACTATTTGACGTGCCCCTACCCGTTCGACCCAAAAATCGCGAT
GTGGCCGCTTTGACAGCCCAAGGGGACGACAGCAATGCTACAAGCAACACCATGGCTTTTTCGCTTCTTACGAGG
AGGGGCAATCGTCAGCAGACACGTACGGTCGAGCTCCCCTCGGATTCAACATTTGCCATTGCCATGAAGACTCAA
CAACAGGCAGAGAGAGAAGAACAGCAGCGCATCAAGAACCTGGTTCTAAACTACGACCTCCAGCATTCCGAAGAC
CAAGAAGGCCATGATCGACTGCCGACCTTCCATCACAACCGAACCGACCGAACAGGCAAAGACCGAGGTCAGAGA
GTCCGGAAGCTGCAACTTAGCGATGTCGACTGGTGA
Transcript >Hirsu2|2941
ATGCTCATCGACAACGCAGTTTACTATGTCGACCCGCCTGAGCGACCCGCCATTGAACGGAAGGAACGAACTCCC
ATGGAGCTCTTTGTCCGTAAACTCGTTTACAGTGATTTGACCAAGAAGAATTACGGGAAGATTTTGAAGCAGATT
CGTAGGTTTCATTGGGAGGAAGCGGATGTTGTCTTCATTCTGGAAAAAGTCTTCTCCAAACCTGGGAAAGTCAAG
TATGGAAACATTCATCTTCTCGGGATTCTATTAAGTGCTTTGAATCGCTACCACTCAGAATTTGTCGTCAAGGTG
ATCGACAATGTCATTGAGTCTGTGTGCGTTGGTTTAGAGCAGAACGATTTCAGGTTTTTTCAACGTCGCATAGCA
GAAGTTAAGTACTTAGGCGAACTCTACAACTATCGGATGTTGGAGCATCCTGTCATTTTCGACAGCATGTACAAA
ATTATGACTTTTGGATACGGCGGTCCGCCGGTCCCTGGACGGTTGAACCCTTTCGATCCGCCAGATGACTTCTTT
CGCATCCGTCTGATCGCTACAGTCCTGGAAACGTGCGGCGTATTTTTCAACAGAGGAGTCGCAGGTAAGAAACTG
GACTACTTCCTGGCTTTCTTTCAGTACTACGTTCACACAAAGTCGTCCCTACCAATGGAAATGGAGTTCATCGTT
CAGGACATTTTCGCCCTTACCCGACCGCAGTGGAAGCTCGCCTCTACCCTAGAGGAAGCAACAAAAGCGTTCCAA
CTGGCCATAGCACAGGATCAAAAGACTTCAGGAGCTGATAGGGCCCTTGAACCAGATGAGGCCACGAGTGTTGCG
TCGTCTGAAGATGAGAACGGAGACGTTGACGACATCGAGCCGTATGGCGATGGTGAGGATGAGACTGCCTCGGAA
GATGACGAAGCCGAGCAGGATGATGAGGATGATTCAGCTCACGAAAGCGACTTCAACGATGAGACGCTAGTCGTG
ACCCGTCAAGAGGAAACGATCGACCCCTATGACGAGGCTGAGTTCGAACGAGAGTATGCGAGAATGATGTCTGAG
AGCTTGGAATCTCGGAAGTTTGAGCGCAAGCAACTATTTGACGTGCCCCTACCCGTTCGACCCAAAAATCGCGAT
GTGGCCGCTTTGACAGCCCAAGGGGACGACAGCAATGCTACAAGCAACACCATGGCTTTTTCGCTTCTTACGAGG
AGGGGCAATCGTCAGCAGACACGTACGGTCGAGCTCCCCTCGGATTCAACATTTGCCATTGCCATGAAGACTCAA
CAACAGGCAGAGAGAGAAGAACAGCAGCGCATCAAGAACCTGGTTCTAAACTACGACCTCCAGCATTCCGAAGAC
CAAGAAGGCCATGATCGACTGCCGACCTTCCATCACAACCGAACCGACCGAACAGGCAAAGACCGAGGTCAGAGA
GTCCGGAAGCTGCAACTTAGCGATGTCGACTGGTGA
Gene >Hirsu2|2941
ATGCTCATCGACAACGCAGTTTACTATGTCGACCCGCCTGAGCGACCCGCCATTGAACGGAAGGAACGAACTCCC
ATGGAGCTCTTTGTCCGTAAACTCGTTTACAGTGATTTGACCAAGAAGAATTACGGGAAGATTTTGAAGCAGATT
CGTAGGTTTCATTGGGAGGAAGCGGATGTGAGACTCACCCTGGCCCTGAAGCCGTCCGAGATCGAGTCATCATCG
CTCACACAGTTCCTAGGTTGTCTTCATTCTGGAAAAAGTCTTCTCCAAACCTGGGAAAGTCAAGTATGGAAACAT
TCATCTTCTCGGGATTCTATTAAGTGCTTTGAATCGCTACCACTCAGAATTTGTCGTCAAGGTGATCGACAATGT
CATTGAGTCTGTGTGCGTTGGTTTAGAGCAGAACGATTTCAGGTTTTTTCAACGTCGCATAGCAGAAGTTAAGTA
CTTAGGCGAACTCTACAACTATCGGATGTTGGAGCATCCTGTCATTTTCGACAGCATGTACAAAATTATGACTTT
TGGATACGGTCGGTCGCCATACTCTACCAAACCCGAGTCAGTCTGATCTTCAAGCTGACCCCCTTGCAGGCGGTC
CGCCGGTCCCTGGACGGTTGAACCCTTTCGATCCGCCAGATGACTTCTTTCGCATCCGTCTGATCGCTACAGTCC
TGGAAACGTGCGGCGTATTTTTCAACAGAGGAGTCGCAGGTAAGAAACTGGACTACTTCCTGGCTTTCTTTCAGG
TACGTCGACCAGGAGCAGTCAGCCTCAGGTCTCCATCTTACCATGGCACCAGTACTACGTTCACACAAAGTCGTC
CCTACCAATGGAAATGGAGTTCATCGTTCAGGACATTTTCGCCCTTACCCGACCGCAGTGGAAGCTCGCCTCTAC
CCTAGAGGAAGCAACAAAAGCGTTCCAACTGGCCATAGCACAGGATCAAAAGACTTCAGGAGCTGATAGGGCCCT
TGAACCAGATGAGGCCACGAGTGTTGCGTCGTCTGAAGATGAGAACGGAGACGTTGACGACATCGAGCCGTATGG
CGATGGTGAGGATGAGACTGCCTCGGAAGATGACGAAGCCGAGGTACGTGATCCAATGAGCACAACAGTGTCTGC
TGAACAGGACCTTGACCCATGTCTTAGCAGGATGATGAGGATGATTCAGCTCACGAAAGCGACTTCAACGATGAG
ACGCTAGTCGTGACCCGTCAAGAGGAAACGATCGACCCCTATGACGAGGCTGAGTTCGAACGAGAGTATGCGAGA
ATGATGTCTGAGAGCTTGGAATCTCGGAAGTTTGAGCGCAAGCAACTATTTGACGTGCCCCTACCCGTTCGACCC
AAAAATCGCGATGTGGCCGCTTTGACAGCCCAAGGGGACGACAGCAATGCTACAAGCAACACCATGGCTTTTTCG
CTTCTTACGAGGAGGGGCAATCGTCAGCAGGTTTGACAACTTCACGGCAAGCCGAAACTGGACCAGACGGGTTAC
TAACGCTGATACAGACACGTACGGTCGAGCTCCCCTCGGATTCAACATTTGCCATTGCCATGAAGACTCAACAAC
AGGCAGAGAGAGAAGAACAGCAGCGCATCAAGAACCTGGTTCTAAACTACGACCTCCAGCATTCCGAAGACCAAG
AAGGCAAGTGTTCTCTTCTTCATCCATTTGTCTCTGTCAATCCAGTCGACGTGAGCTTTACTTACAAATCTGTGT
GGACAGGCCATGATCGACTGCCGACCTTCCATCACAACCGAACCGACCGAACAGGCAAAGACCGAGGTCAGAGAG
TCCGGAAGCTGCAACTTAGCGATGTCGACTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail