Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2937
Gene name
LocationContig_1733:1961..3629
Strand-
Gene length (bp)1668
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 2.2E-26 7 213

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99288|DET1_YEAST Broad-range acid phosphatase DET1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DET1 PE=1 SV=1 2 225 5.0E-48
sp|Q9MAA2|AT74_ARATH Phosphoglycerate mutase-like protein AT74 OS=Arabidopsis thaliana GN=At3g05170 PE=2 SV=1 4 223 6.0E-45
sp|O04035|AT74H_ARATH Phosphoglycerate mutase-like protein AT74H OS=Arabidopsis thaliana GN=At1g08940 PE=3 SV=2 4 216 8.0E-45

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2937
MAKPRLIIVIRHAQSEGNKNREIHQTIPDHRVKLTSEGWAQANEAGRRLRRLLRPDDTLQFFTSPYRRTRETTQG
ILATLTSDTPEPSSFRRSDIKVWEEPRLREQDFGNFQPCSAEMERMWQERADYGHFFYRIPNGESAADAYDRISG
FNESLWRQFEEEDFASVCVLVTHGLMSRVFLMKWYHFTVEYFEDLRNIDHCEFLTMRKEDNGKYLLENKLRTWSE
LRRERVKAGTVDDTALDRARTVVVSRRWGGCPNGCNHTNHFNKRHDLEALRQRDIERSGKSVNGNGGGMSIASRR
QRHHRVQRTSAPVVDGDGDEDRDRDRDRDREVDDAGDYDDDDDDDGDGDGGCEIDDGDYGNGAGRPDRVGDGGGA
EPAQLTRARTVEDVISSPDGTPSFITASHRLRGFKLPHLHVGRDFGGSYSGHNSTAGSDSDGSEEEDPRLRRLAL
LNARLRAASGDDSADEESADGSGSGGGFANRLGDTPGSDIVWGMDDLDAAEKEDRSIRGSVY*
Coding >Hirsu2|2937
ATGGCCAAGCCGCGGCTGATCATCGTCATCCGCCATGCCCAGTCCGAGGGCAACAAAAACCGCGAAATCCATCAG
ACGATCCCGGATCATCGGGTCAAGCTCACCTCGGAGGGCTGGGCCCAAGCCAATGAAGCCGGCCGTCGCCTCCGC
AGACTCCTCCGCCCCGACGACACCCTGCAATTCTTCACCTCTCCCTACCGGCGCACCCGCGAGACGACGCAGGGC
ATCCTCGCCACCCTCACCTCGGACACGCCCGAGCCCTCGTCCTTCCGCCGCTCCGACATCAAGGTCTGGGAGGAG
CCCCGGCTGCGGGAACAAGACTTTGGCAACTTCCAGCCCTGCAGCGCCGAGATGGAGCGCATGTGGCAGGAGAGG
GCCGACTACGGCCACTTTTTCTATCGCATCCCCAACGGCGAGAGCGCCGCCGACGCCTACGACCGCATCAGCGGC
TTCAACGAGAGCCTGTGGCGCCAGTTTGAAGAGGAAGACTTCGCCAGCGTCTGCGTCCTGGTCACCCACGGCCTG
ATGTCACGCGTCTTCCTCATGAAGTGGTACCACTTCACCGTCGAGTACTTCGAGGACCTGCGCAACATCGATCAC
TGCGAGTTCCTCACCATGCGCAAGGAGGACAACGGCAAGTACCTGCTCGAGAACAAGCTGCGGACCTGGTCGGAG
CTGCGCCGCGAGCGCGTCAAGGCCGGCACCGTCGACGACACGGCGCTCGACCGCGCCCGCACCGTCGTCGTCAGC
CGGCGCTGGGGAGGCTGCCCCAACGGCTGCAACCACACCAACCACTTCAACAAGCGCCACGACCTCGAAGCCCTG
CGGCAGAGGGACATTGAGCGCAGCGGCAAGAGCGTCAACGGCAACGGCGGAGGCATGTCCATCGCCAGTCGCAGG
CAGCGCCACCATCGCGTGCAGCGCACCAGCGCGCCCGTCGTCGACGGCGACGGCGACGAGGACCGGGACCGGGAC
CGGGACCGGGACCGGGAAGTCGACGACGCCGGGGACTACGACGACGACGACGACGACGACGGGGACGGGGACGGG
GGCTGCGAAATCGACGACGGCGACTACGGGAACGGAGCCGGACGCCCCGACCGGGTCGGCGACGGCGGCGGAGCG
GAGCCGGCCCAGCTCACGCGGGCGCGCACGGTCGAAGACGTCATCTCGTCGCCCGACGGGACGCCGTCGTTCATC
ACGGCGTCGCACCGGCTCCGCGGCTTCAAGCTGCCGCACCTGCACGTCGGCCGGGACTTTGGCGGGTCCTACTCG
GGCCACAACTCGACGGCTGGTAGCGACTCGGACGGGTCGGAGGAGGAGGACCCGCGGCTGCGGCGGCTGGCGCTG
CTGAACGCGCGGCTGCGCGCGGCGAGCGGCGACGACTCGGCCGACGAGGAGTCGGCCGACGGCAGCGGCAGCGGC
GGCGGCTTCGCCAACCGGCTGGGCGACACGCCCGGCTCCGACATCGTCTGGGGCATGGACGACCTGGACGCGGCG
GAGAAGGAGGACCGGAGCATCCGCGGCAGCGTCTACTGA
Transcript >Hirsu2|2937
ATGGCCAAGCCGCGGCTGATCATCGTCATCCGCCATGCCCAGTCCGAGGGCAACAAAAACCGCGAAATCCATCAG
ACGATCCCGGATCATCGGGTCAAGCTCACCTCGGAGGGCTGGGCCCAAGCCAATGAAGCCGGCCGTCGCCTCCGC
AGACTCCTCCGCCCCGACGACACCCTGCAATTCTTCACCTCTCCCTACCGGCGCACCCGCGAGACGACGCAGGGC
ATCCTCGCCACCCTCACCTCGGACACGCCCGAGCCCTCGTCCTTCCGCCGCTCCGACATCAAGGTCTGGGAGGAG
CCCCGGCTGCGGGAACAAGACTTTGGCAACTTCCAGCCCTGCAGCGCCGAGATGGAGCGCATGTGGCAGGAGAGG
GCCGACTACGGCCACTTTTTCTATCGCATCCCCAACGGCGAGAGCGCCGCCGACGCCTACGACCGCATCAGCGGC
TTCAACGAGAGCCTGTGGCGCCAGTTTGAAGAGGAAGACTTCGCCAGCGTCTGCGTCCTGGTCACCCACGGCCTG
ATGTCACGCGTCTTCCTCATGAAGTGGTACCACTTCACCGTCGAGTACTTCGAGGACCTGCGCAACATCGATCAC
TGCGAGTTCCTCACCATGCGCAAGGAGGACAACGGCAAGTACCTGCTCGAGAACAAGCTGCGGACCTGGTCGGAG
CTGCGCCGCGAGCGCGTCAAGGCCGGCACCGTCGACGACACGGCGCTCGACCGCGCCCGCACCGTCGTCGTCAGC
CGGCGCTGGGGAGGCTGCCCCAACGGCTGCAACCACACCAACCACTTCAACAAGCGCCACGACCTCGAAGCCCTG
CGGCAGAGGGACATTGAGCGCAGCGGCAAGAGCGTCAACGGCAACGGCGGAGGCATGTCCATCGCCAGTCGCAGG
CAGCGCCACCATCGCGTGCAGCGCACCAGCGCGCCCGTCGTCGACGGCGACGGCGACGAGGACCGGGACCGGGAC
CGGGACCGGGACCGGGAAGTCGACGACGCCGGGGACTACGACGACGACGACGACGACGACGGGGACGGGGACGGG
GGCTGCGAAATCGACGACGGCGACTACGGGAACGGAGCCGGACGCCCCGACCGGGTCGGCGACGGCGGCGGAGCG
GAGCCGGCCCAGCTCACGCGGGCGCGCACGGTCGAAGACGTCATCTCGTCGCCCGACGGGACGCCGTCGTTCATC
ACGGCGTCGCACCGGCTCCGCGGCTTCAAGCTGCCGCACCTGCACGTCGGCCGGGACTTTGGCGGGTCCTACTCG
GGCCACAACTCGACGGCTGGTAGCGACTCGGACGGGTCGGAGGAGGAGGACCCGCGGCTGCGGCGGCTGGCGCTG
CTGAACGCGCGGCTGCGCGCGGCGAGCGGCGACGACTCGGCCGACGAGGAGTCGGCCGACGGCAGCGGCAGCGGC
GGCGGCTTCGCCAACCGGCTGGGCGACACGCCCGGCTCCGACATCGTCTGGGGCATGGACGACCTGGACGCGGCG
GAGAAGGAGGACCGGAGCATCCGCGGCAGCGTCTACTGA
Gene >Hirsu2|2937
ATGGCCAAGCCGCGGCTGATCATCGTCATCCGCCATGCCCAGTCCGAGGGCAACAGTGAGCCTCTCCTCGATCGG
CCCCTCTGTACTTCCCTTGGCCGGTGCTGACACGGCACCCGTCGTCGGCTAGAAAACCGCGAAATCCATCAGACG
ATCCCGGATCATCGGGTCAAGCTCACCTCGGAGGGCTGGGCCCAAGCCAATGAAGCCGGCCGTCGCCTCCGCAGA
CTCCTCCGCCCCGACGACACCCTGCAATTCTTCACCTCTCCCTACCGGCGCACCCGCGAGACGACGCAGGGCATC
CTCGCCACCCTCACCTCGGACACGCCCGAGCCCTCGTCCTTCCGCCGCTCCGACATCAAGGTCTGGGAGGAGCCC
CGGCTGCGGGAACAAGACTTTGGCAACTTCCAGCCCTGCAGCGCCGAGATGGAGCGCATGTGGCAGGAGAGGGCC
GACTACGGCCACTTTTTCTATCGCATCCCCAACGGCGAGAGCGCCGCCGACGCCTACGACCGCATCAGCGGCTTC
AACGAGAGCCTGTGGCGCCAGTTTGAAGAGGAAGACTTCGCCAGCGTCTGCGTCCTGGGTACGTCTTCCGCAGCC
CCGACGGCATGTGCCTCACTGACCTTGCTCGCCTCGACAGTCACCCACGGCCTGATGTCACGCGTCTTCCTCATG
AAGTGGTACCACTTCACCGTCGAGTACTTCGAGGACCTGCGCAACATCGATCACTGCGAGTTCCTCACCATGCGC
AAGGAGGACAACGGCAAGTACCTGCTCGAGAACAAGCTGCGGACCTGGTCGGAGCTGCGCCGCGAGCGCGTCAAG
GCCGGCACCGTCGACGACACGGCGCTCGACCGCGCCCGCACCGTCGTCGTCAGCCGGCGCTGGGGAGGCTGCCCC
AACGGCTGCAACCACACCAACCACTTCAACAAGCGCCACGACCTCGAAGCCCTGCGGCAGAGGGACATTGAGCGC
AGCGGCAAGAGCGTCAACGGCAACGGCGGAGGCATGTCCATCGCCAGTCGCAGGCAGCGCCACCATCGCGTGCAG
CGCACCAGCGCGCCCGTCGTCGACGGCGACGGCGACGAGGACCGGGACCGGGACCGGGACCGGGACCGGGAAGTC
GACGACGCCGGGGACTACGACGACGACGACGACGACGACGGGGACGGGGACGGGGGCTGCGAAATCGACGACGGC
GACTACGGGAACGGAGCCGGACGCCCCGACCGGGTCGGCGACGGCGGCGGAGCGGAGCCGGCCCAGCTCACGCGG
GCGCGCACGGTCGAAGACGTCATCTCGTCGCCCGACGGGACGCCGTCGTTCATCACGGCGTCGCACCGGCTCCGC
GGCTTCAAGCTGCCGCACCTGCACGTCGGCCGGGACTTTGGCGGGTCCTACTCGGGCCACAACTCGACGGCTGGT
AGCGACTCGGACGGGTCGGAGGAGGAGGACCCGCGGCTGCGGCGGCTGGCGCTGCTGAACGCGCGGCTGCGCGCG
GCGAGCGGCGACGACTCGGCCGACGAGGAGTCGGCCGACGGCAGCGGCAGCGGCGGCGGCTTCGCCAACCGGCTG
GGCGACACGCCCGGCTCCGACATCGTCTGGGGCATGGACGACCTGGACGCGGCGGAGAAGGAGGACCGGAGCATC
CGCGGCAGCGTCTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail