Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2931
Gene name
LocationContig_1730:1391..2147
Strand+
Gene length (bp)756
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09419 PGP_phosphatase Mitochondrial PGP phosphatase 5.6E-66 5 179

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38812|GEP4_YEAST Phosphatidylglycerophosphatase GEP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEP4 PE=1 SV=1 3 200 6.0E-59
sp|Q9Y7U3|GEP4_SCHPO Probable phosphatidylglycerophosphatase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gep4 PE=3 SV=2 1 179 1.0E-28

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2931
MNFNISASLNASRLLFRPSLCLPHYTVPTFNDLPIPLDRDIQKDGRKADIKAVVLDKDDCFAYPDTNEVHEPYRQ
HFEALKRAYPGRRLLVVSNTAGATGWDKQLKQAAQLEKSTGVFVLAHSAKKPGCGSEVMAYFKQHPETGVTHPSH
VAVVGDRLMTDVMLANMMGSWGFWIRDGVVPLRQKSIFSRLERNLASFLAASGAQAPWPQTRTRQ*
Coding >Hirsu2|2931
ATGAACTTCAACATCTCGGCGTCTCTCAACGCCTCGAGGCTGCTCTTCAGGCCTAGCCTATGCCTCCCTCACTAC
ACCGTACCCACGTTCAACGACCTGCCCATCCCGCTCGACAGGGACATCCAGAAGGACGGCCGAAAGGCCGACATC
AAGGCAGTCGTCCTCGACAAGGACGACTGCTTCGCCTATCCGGACACGAATGAGGTCCATGAGCCGTACAGACAA
CACTTCGAGGCGCTCAAGAGAGCGTACCCTGGCCGGCGTCTGCTCGTGGTGTCCAACACCGCCGGCGCCACGGGC
TGGGACAAGCAGCTGAAGCAGGCTGCGCAGCTGGAGAAGAGCACCGGCGTCTTCGTCTTGGCTCACTCTGCCAAG
AAGCCCGGGTGCGGCTCCGAGGTCATGGCCTACTTCAAGCAGCACCCGGAGACGGGAGTCACTCACCCCTCTCAC
GTCGCCGTCGTCGGCGACCGGCTGATGACAGACGTCATGCTGGCCAACATGATGGGCTCTTGGGGGTTCTGGATC
AGAGACGGGGTCGTCCCCCTGCGGCAAAAGAGCATCTTCTCCCGATTGGAGCGCAACCTGGCCTCGTTCCTGGCA
GCAAGCGGAGCACAAGCCCCGTGGCCTCAGACTCGGACCAGACAGTGA
Transcript >Hirsu2|2931
ATGAACTTCAACATCTCGGCGTCTCTCAACGCCTCGAGGCTGCTCTTCAGGCCTAGCCTATGCCTCCCTCACTAC
ACCGTACCCACGTTCAACGACCTGCCCATCCCGCTCGACAGGGACATCCAGAAGGACGGCCGAAAGGCCGACATC
AAGGCAGTCGTCCTCGACAAGGACGACTGCTTCGCCTATCCGGACACGAATGAGGTCCATGAGCCGTACAGACAA
CACTTCGAGGCGCTCAAGAGAGCGTACCCTGGCCGGCGTCTGCTCGTGGTGTCCAACACCGCCGGCGCCACGGGC
TGGGACAAGCAGCTGAAGCAGGCTGCGCAGCTGGAGAAGAGCACCGGCGTCTTCGTCTTGGCTCACTCTGCCAAG
AAGCCCGGGTGCGGCTCCGAGGTCATGGCCTACTTCAAGCAGCACCCGGAGACGGGAGTCACTCACCCCTCTCAC
GTCGCCGTCGTCGGCGACCGGCTGATGACAGACGTCATGCTGGCCAACATGATGGGCTCTTGGGGGTTCTGGATC
AGAGACGGGGTCGTCCCCCTGCGGCAAAAGAGCATCTTCTCCCGATTGGAGCGCAACCTGGCCTCGTTCCTGGCA
GCAAGCGGAGCACAAGCCCCGTGGCCTCAGACTCGGACCAGACAGTGA
Gene >Hirsu2|2931
ATGAACTTCAACATCTCGGCGTCTCTCAACGCCTCGAGGCTGCTCTTCAGGCCTAGCCTATGCCTCCCTCACTAC
ACCGTACCCACGTTCAACGACCTGCCCATCCCGCTCGACAGGGACATCCAGAAGGACGGCCGAAAGGCCGACATC
AAGGCAGTCGTCCTCGACAAGGACGACTGCTTCGCCTATCCGGACACGAATGAGGTCCATGAGCCGTACAGAGTA
AGAGGTGCTCCTCTGCTCAGCCCAATCGGGACTCGCTGACCGTGCGACAGCAACACTTCGAGGCGCTCAAGAGAG
CGTACCCTGGCCGGCGTCTGCTCGTGGTGTCCAACACCGCCGGCGCCACGGGCTGGGACAAGCAGCTGAAGCAGG
CTGCGCAGCTGGAGAAGAGCACCGGCGTCTTCGTCTTGGCTCACTCTGCCAAGAAGCCCGGGTGCGGCTCCGAGG
TCATGGCCTACTTCAAGCAGCACCCGGAGACGGGAGTCACTCACCCCTCTCACGTCGCCGTCGTCGGCGACCGGC
TGATGACAGACGTCATGCTGGCCAACATGATGGGCTCTTGGGGGTTCTGGATCAGAGACGGGGTCGTCCCCCTGC
GGCAAAAGAGCATCGTGCGTTCTCGGCCCCCGCGTCAGTGACGATCGACTTCGCCTAACGTGATTGTAGTTCTCC
CGATTGGAGCGCAACCTGGCCTCGTTCCTGGCAGCAAGCGGAGCACAAGCCCCGTGGCCTCAGACTCGGACCAGA
CAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail