Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2927
Gene name
LocationContig_173:23180..25960
Strand+
Gene length (bp)2780
Transcript length (bp)2637
Coding sequence length (bp)2637
Protein length (aa) 879

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 3.2E-50 548 788
PF02260 FATC FATC domain 1.1E-11 848 877

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 1 878 0.0E+00
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 1 878 0.0E+00
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 10 878 0.0E+00
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 1 878 0.0E+00
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 1 878 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 1 878 0.0E+00
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 1 878 0.0E+00
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 10 878 0.0E+00
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 1 878 0.0E+00
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 1 878 0.0E+00
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 41 877 3.0E-168
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 142 878 1.0E-131
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 18 877 6.0E-131
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 142 878 2.0E-128
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 143 878 1.0E-127
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 94 877 4.0E-117
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 114 877 5.0E-117
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 44 877 3.0E-116
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 143 877 1.0E-114
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 85 877 2.0E-113
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 295 877 2.0E-113
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 142 877 2.0E-112
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 96 877 5.0E-112
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 229 877 2.0E-108
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 289 874 7.0E-103
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 348 877 8.0E-65
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 348 877 8.0E-63
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 348 877 6.0E-60
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 345 877 1.0E-59
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 355 877 2.0E-57
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 355 877 2.0E-57
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 308 877 3.0E-57
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 355 789 8.0E-57
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 351 877 1.0E-56
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 366 781 1.0E-53
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 349 877 2.0E-53
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 349 877 6.0E-53
sp|Q9VXG8|ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster GN=mei-41 PE=1 SV=2 316 877 2.0E-52
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 345 877 2.0E-50
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 491 877 3.0E-48
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 496 877 4.0E-48
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 434 877 2.0E-47
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 506 877 6.0E-47
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 434 877 1.0E-46
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 434 877 1.0E-46
sp|Q9N3Q4|ATM_CAEEL Serine/threonine-protein kinase ATM OS=Caenorhabditis elegans GN=atm-1 PE=3 SV=3 357 877 2.0E-46
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 497 877 4.0E-45
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 518 877 6.0E-45
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 483 877 6.0E-44
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 498 877 6.0E-43
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 528 877 6.0E-43
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 528 877 6.0E-42
sp|Q8SSE7|ATR_ENCCU Probable serine/threonine-protein kinase MEC1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MEC1 PE=3 SV=2 507 877 5.0E-41
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 518 787 4.0E-40
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 518 787 5.0E-40
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 455 877 3.0E-35
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 485 877 1.0E-34
sp|Q70PP2|SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster GN=nonC PE=1 SV=2 447 787 2.0E-34
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 473 877 2.0E-34
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 473 877 3.0E-33
sp|Q54UC0|PRKDC_DICDI DNA-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=dnapkcs PE=3 SV=2 492 797 3.0E-33
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 492 877 7.0E-33
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 526 876 3.0E-31
sp|O01510|SMG1_CAEEL Serine/threonine-protein kinase smg-1 OS=Caenorhabditis elegans GN=smg-1 PE=1 SV=3 505 787 1.0E-29
sp|Q61CW2|SMG1_CAEBR Serine/threonine-protein kinase smg-1 OS=Caenorhabditis briggsae GN=smg-1 PE=3 SV=3 505 787 2.0E-29
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 670 786 4.0E-25
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 541 800 6.0E-13
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 544 779 2.0E-12
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 518 778 6.0E-12
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 537 778 3.0E-11
sp|O88763|PK3C3_RAT Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Rattus norvegicus GN=Pik3c3 PE=1 SV=1 518 778 4.0E-11
sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens GN=PIK3C3 PE=1 SV=1 518 778 6.0E-11
sp|Q5D891|PK3C3_PIG Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Sus scrofa GN=PIK3C3 PE=2 SV=1 518 778 7.0E-11
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 544 781 1.0E-10
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 515 606 3.0E-07
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 544 779 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2927
MQSLTRASVNATALRSRLTALAALSELDDLLNVAEPTEMGDVLQKFKHRSHWMKSGLYDDVSQILSCRETTASML
SQHASTMSSVKLPASSWRRMQVETMLTASAIYRYHQATQESLNISTALNKLVPVCEDLNLHVDAAVKIEVANSLW
DYGEMSTSIRMLQGIDKDSCLEKQTIPVSRSELLSKIGHKVSVARLEKPRDIQKAYLEPALRELKSSHSHIAEEG
AVYHQFATFCDEQLQDADGLEDLARLQNLRKRKSEEVADLQALIASTKESQTRAKYLNFLSKEKQWLGLDEQELR
RVEQTRSEFIRLSLENYLLSLAASDEYNNDALRFTALWLERSLEEATNKAVARHLEQVPTRKFANLMNQLTSRLQ
NQDTTFQRLLFDLVLRICTDHPYHGMYQIWSGMKAKAQQKDEVAALRVKATEKVAQRLAGIKDVAQIWLSIDKTS
KYYHGLAVDRNTSKYKSGAKLPLKECAAGQNLMIYLARYKIPPPTMHIEVSAARDYSGVPHVVKLEPTMTIASGL
SAPKIITAVGSDGKKYKQLVKGGHDDLRQDAIMEQVFAAVSSLLKLHRSSQQRNLGIRTYKVLPLTASSGLIEFV
PNTIPLHDFLMPAHERYHPRDLKGSQCRKEIMNVQSRPVETRISTYRKVTEKFHPVMRYFFMEYFMDPDEWFTKR
LAYTRSTAAISILGHVLGLGDRHGHNILLDTKTGEAVHIDLGVAFEAGRILPVPELVPFRLTRDIVDGMGITKTE
GVFRRCCEFTLDALREEQYSIMTVLDVLRYDPLYTWSISPVRLAKLQKARQEGEAGADDSEQGETEAKRARKAAG
HFNEPSEADRALEVVRKKLSKTLSVTATVNDLINQATDERNLAVLYSGWAAYA*
Coding >Hirsu2|2927
ATGCAGAGCTTGACCCGTGCCAGTGTCAACGCAACAGCGCTGAGAAGTCGGTTGACGGCATTGGCAGCCCTGTCA
GAGCTTGACGATCTCCTCAACGTCGCGGAACCCACTGAGATGGGCGACGTCTTGCAAAAGTTTAAACATCGCAGT
CACTGGATGAAGAGCGGACTGTACGACGATGTGAGCCAGATCCTGTCCTGCCGAGAGACGACGGCGAGCATGTTG
AGCCAGCATGCCTCGACCATGAGTAGCGTAAAGCTCCCAGCAAGCTCGTGGAGGCGAATGCAAGTGGAGACGATG
CTCACGGCCTCTGCCATCTACCGCTATCACCAAGCAACCCAGGAGTCGCTGAACATCTCAACGGCGCTCAACAAG
CTGGTCCCCGTCTGCGAAGACTTGAACCTCCACGTGGATGCTGCTGTCAAGATCGAAGTTGCCAACTCGCTGTGG
GATTACGGAGAAATGAGCACCAGCATACGGATGCTTCAGGGCATTGACAAGGATTCTTGCCTGGAGAAGCAGACG
ATTCCTGTCAGCCGATCCGAGCTGCTCTCCAAAATCGGCCACAAGGTCTCTGTTGCCCGGCTCGAGAAGCCTCGA
GACATTCAAAAGGCGTACCTCGAGCCGGCGCTTAGGGAGCTCAAAAGCAGCCACAGCCACATCGCGGAAGAGGGC
GCCGTCTATCACCAATTTGCGACCTTTTGCGACGAGCAGCTGCAAGATGCCGATGGGCTCGAGGACCTGGCGAGG
CTGCAGAACCTGAGAAAGCGGAAGAGCGAGGAGGTGGCCGATCTACAGGCACTCATCGCGTCTACCAAAGAGTCG
CAAACGAGGGCCAAGTATCTCAACTTCCTCTCGAAAGAGAAGCAGTGGCTGGGCCTGGACGAGCAAGAGCTGCGG
CGCGTGGAGCAGACGCGAAGCGAGTTTATACGGCTCAGCCTGGAGAACTACCTGCTGTCTCTTGCGGCCTCCGAC
GAGTACAATAACGACGCGCTGCGCTTCACGGCCCTCTGGCTCGAGCGGTCGTTGGAGGAGGCGACGAACAAGGCG
GTGGCGCGCCATCTGGAGCAGGTCCCGACGAGGAAGTTCGCCAACCTGATGAACCAGTTGACGTCGCGGCTTCAG
AACCAGGACACCACTTTCCAGAGGCTGCTCTTCGACCTGGTCCTGAGGATCTGCACTGACCACCCGTACCACGGA
ATGTACCAGATCTGGTCGGGGATGAAGGCCAAAGCCCAACAGAAGGACGAGGTGGCTGCCCTCCGCGTGAAGGCG
ACGGAAAAGGTCGCCCAGCGGCTGGCTGGCATCAAGGACGTGGCCCAGATCTGGTTGTCCATCGACAAGACGAGC
AAGTACTATCACGGGCTCGCCGTCGATAGAAACACGTCCAAGTACAAGTCCGGCGCCAAGCTTCCCCTGAAGGAG
TGTGCGGCCGGGCAGAATCTGATGATCTACTTGGCCCGGTACAAGATTCCGCCGCCGACCATGCACATTGAGGTT
TCGGCCGCCCGAGACTACTCGGGCGTGCCGCATGTCGTGAAGCTGGAGCCTACGATGACGATAGCATCCGGCCTC
AGCGCGCCCAAGATCATCACGGCCGTGGGCAGCGACGGAAAGAAGTACAAGCAGCTGGTCAAGGGCGGCCACGAC
GACCTGCGGCAGGACGCCATCATGGAGCAAGTCTTTGCTGCCGTCTCGTCGCTTCTGAAGCTACACCGAAGCTCC
CAGCAGAGGAATCTGGGGATTCGAACATACAAGGTCCTCCCGCTCACCGCGTCGTCTGGCCTGATCGAGTTTGTC
CCGAACACGATCCCACTGCACGACTTTCTCATGCCAGCGCACGAGCGGTACCATCCCAGGGATCTGAAGGGATCG
CAGTGCCGGAAGGAGATTATGAATGTGCAGAGCCGGCCGGTGGAAACACGGATCAGCACTTATCGCAAGGTGACG
GAGAAGTTTCACCCGGTCATGAGATACTTCTTCATGGAATACTTCATGGACCCGGACGAATGGTTCACCAAGCGG
CTGGCATACACAAGAAGCACGGCAGCGATATCAATACTCGGGCACGTGCTCGGCTTGGGGGACCGACATGGACAC
AACATCCTGCTGGATACCAAGACTGGCGAGGCGGTACACATCGACCTGGGCGTGGCGTTCGAGGCGGGACGGATC
CTGCCAGTGCCCGAGCTGGTGCCGTTTCGGCTCACGCGAGACATTGTGGACGGGATGGGAATCACAAAGACGGAG
GGCGTGTTTCGCCGCTGCTGCGAGTTCACCTTGGATGCCCTCCGGGAGGAGCAGTACTCGATCATGACAGTCTTG
GACGTGCTGCGCTACGACCCGCTGTACACCTGGTCCATCTCGCCGGTCAGGCTGGCCAAGCTGCAGAAGGCAAGA
CAGGAGGGTGAGGCGGGAGCCGACGATTCGGAGCAGGGCGAGACCGAGGCCAAGCGGGCGCGGAAGGCGGCGGGC
CACTTCAACGAACCGTCCGAGGCGGACCGAGCGCTGGAGGTGGTGAGGAAGAAGCTTTCCAAGACGCTCAGCGTG
ACGGCAACGGTCAACGACCTCATTAACCAGGCGACGGACGAGCGAAACCTGGCGGTTCTGTACTCTGGGTGGGCA
GCGTATGCCTGA
Transcript >Hirsu2|2927
ATGCAGAGCTTGACCCGTGCCAGTGTCAACGCAACAGCGCTGAGAAGTCGGTTGACGGCATTGGCAGCCCTGTCA
GAGCTTGACGATCTCCTCAACGTCGCGGAACCCACTGAGATGGGCGACGTCTTGCAAAAGTTTAAACATCGCAGT
CACTGGATGAAGAGCGGACTGTACGACGATGTGAGCCAGATCCTGTCCTGCCGAGAGACGACGGCGAGCATGTTG
AGCCAGCATGCCTCGACCATGAGTAGCGTAAAGCTCCCAGCAAGCTCGTGGAGGCGAATGCAAGTGGAGACGATG
CTCACGGCCTCTGCCATCTACCGCTATCACCAAGCAACCCAGGAGTCGCTGAACATCTCAACGGCGCTCAACAAG
CTGGTCCCCGTCTGCGAAGACTTGAACCTCCACGTGGATGCTGCTGTCAAGATCGAAGTTGCCAACTCGCTGTGG
GATTACGGAGAAATGAGCACCAGCATACGGATGCTTCAGGGCATTGACAAGGATTCTTGCCTGGAGAAGCAGACG
ATTCCTGTCAGCCGATCCGAGCTGCTCTCCAAAATCGGCCACAAGGTCTCTGTTGCCCGGCTCGAGAAGCCTCGA
GACATTCAAAAGGCGTACCTCGAGCCGGCGCTTAGGGAGCTCAAAAGCAGCCACAGCCACATCGCGGAAGAGGGC
GCCGTCTATCACCAATTTGCGACCTTTTGCGACGAGCAGCTGCAAGATGCCGATGGGCTCGAGGACCTGGCGAGG
CTGCAGAACCTGAGAAAGCGGAAGAGCGAGGAGGTGGCCGATCTACAGGCACTCATCGCGTCTACCAAAGAGTCG
CAAACGAGGGCCAAGTATCTCAACTTCCTCTCGAAAGAGAAGCAGTGGCTGGGCCTGGACGAGCAAGAGCTGCGG
CGCGTGGAGCAGACGCGAAGCGAGTTTATACGGCTCAGCCTGGAGAACTACCTGCTGTCTCTTGCGGCCTCCGAC
GAGTACAATAACGACGCGCTGCGCTTCACGGCCCTCTGGCTCGAGCGGTCGTTGGAGGAGGCGACGAACAAGGCG
GTGGCGCGCCATCTGGAGCAGGTCCCGACGAGGAAGTTCGCCAACCTGATGAACCAGTTGACGTCGCGGCTTCAG
AACCAGGACACCACTTTCCAGAGGCTGCTCTTCGACCTGGTCCTGAGGATCTGCACTGACCACCCGTACCACGGA
ATGTACCAGATCTGGTCGGGGATGAAGGCCAAAGCCCAACAGAAGGACGAGGTGGCTGCCCTCCGCGTGAAGGCG
ACGGAAAAGGTCGCCCAGCGGCTGGCTGGCATCAAGGACGTGGCCCAGATCTGGTTGTCCATCGACAAGACGAGC
AAGTACTATCACGGGCTCGCCGTCGATAGAAACACGTCCAAGTACAAGTCCGGCGCCAAGCTTCCCCTGAAGGAG
TGTGCGGCCGGGCAGAATCTGATGATCTACTTGGCCCGGTACAAGATTCCGCCGCCGACCATGCACATTGAGGTT
TCGGCCGCCCGAGACTACTCGGGCGTGCCGCATGTCGTGAAGCTGGAGCCTACGATGACGATAGCATCCGGCCTC
AGCGCGCCCAAGATCATCACGGCCGTGGGCAGCGACGGAAAGAAGTACAAGCAGCTGGTCAAGGGCGGCCACGAC
GACCTGCGGCAGGACGCCATCATGGAGCAAGTCTTTGCTGCCGTCTCGTCGCTTCTGAAGCTACACCGAAGCTCC
CAGCAGAGGAATCTGGGGATTCGAACATACAAGGTCCTCCCGCTCACCGCGTCGTCTGGCCTGATCGAGTTTGTC
CCGAACACGATCCCACTGCACGACTTTCTCATGCCAGCGCACGAGCGGTACCATCCCAGGGATCTGAAGGGATCG
CAGTGCCGGAAGGAGATTATGAATGTGCAGAGCCGGCCGGTGGAAACACGGATCAGCACTTATCGCAAGGTGACG
GAGAAGTTTCACCCGGTCATGAGATACTTCTTCATGGAATACTTCATGGACCCGGACGAATGGTTCACCAAGCGG
CTGGCATACACAAGAAGCACGGCAGCGATATCAATACTCGGGCACGTGCTCGGCTTGGGGGACCGACATGGACAC
AACATCCTGCTGGATACCAAGACTGGCGAGGCGGTACACATCGACCTGGGCGTGGCGTTCGAGGCGGGACGGATC
CTGCCAGTGCCCGAGCTGGTGCCGTTTCGGCTCACGCGAGACATTGTGGACGGGATGGGAATCACAAAGACGGAG
GGCGTGTTTCGCCGCTGCTGCGAGTTCACCTTGGATGCCCTCCGGGAGGAGCAGTACTCGATCATGACAGTCTTG
GACGTGCTGCGCTACGACCCGCTGTACACCTGGTCCATCTCGCCGGTCAGGCTGGCCAAGCTGCAGAAGGCAAGA
CAGGAGGGTGAGGCGGGAGCCGACGATTCGGAGCAGGGCGAGACCGAGGCCAAGCGGGCGCGGAAGGCGGCGGGC
CACTTCAACGAACCGTCCGAGGCGGACCGAGCGCTGGAGGTGGTGAGGAAGAAGCTTTCCAAGACGCTCAGCGTG
ACGGCAACGGTCAACGACCTCATTAACCAGGCGACGGACGAGCGAAACCTGGCGGTTCTGTACTCTGGGTGGGCA
GCGTATGCCTGA
Gene >Hirsu2|2927
ATGCAGAGCTTGACCCGTGCCAGTGTCAACGCAACAGCGCTGAGAAGTCGGTTGACGGCATTGGCAGCCCTGTCA
GAGCTTGACGATCTCCTCAACGTCGCGGAACCCACTGAGATGGGCGACGTCTTGCAAAAGTTTAAACATCGCAGT
CACTGGATGAAGAGCGGACTGTAGGTGGACCAGCCATCCCTACCATATCGTGCGAAGGACGAACATTACTGACTG
GACCCTCAGGTACGACGATGTGAGCCAGATCCTGTCCTGCCGAGAGACGACGGCGAGCATGTTGAGCCAGCATGC
CTCGACCATGAGTAGCGTAAAGCTCCCAGCAAGCTCGTGGAGGCGAATGCAAGTGGAGACGATGCTCACGGCCTC
TGCCATCTACCGCTATCACCAAGCAACCCAGGAGTCGCTGAACATCTCAACGGCGCTCAACAAGCTGGTCCCCGT
CTGCGAAGACTTGAACCTCCACGTGGATGCTGCTGTCAAGATCGAAGTTGCCAACTCGCTGTGGGATTACGGAGA
AATGAGCACCAGCATACGGATGCTTCAGGGCATTGACAAGGATTCTTGCCTGGAGAAGCAGACGATTCCTGTCAG
CCGATCCGAGCTGCTCTCCAAAATCGGCCACAAGGTCTCTGTTGCCCGGCTCGAGAAGCCTCGAGACATTCAAAA
GGCGTACCTCGAGCCGGCGCTTAGGGAGCTCAAAAGCAGCCACAGCCACATCGCGGAAGAGGGCGCCGTCTATCA
CCAATTTGCGACCTTTTGCGACGAGCAGCTGCAAGATGCCGATGGGCTCGAGGACCTGGCGAGGCTGCAGAACCT
GAGAAAGCGGAAGAGCGAGGAGGTGGCCGATCTACAGGCACTCATCGCGTCTACCAAAGAGTCGCAAACGAGGGC
CAAGTATCTCAACTTCCTCTCGAAAGAGAAGCAGTGGCTGGGCCTGGACGAGCAAGAGCTGCGGCGCGTGGAGCA
GACGCGAAGCGAGTTTATACGGCTCAGCCTGGAGAACTACCTGCTGTCTCTTGCGGCCTCCGACGAGTACAATAA
CGACGCGCTGCGCTTCACGGCCCTCTGGCTCGAGCGGTCGTTGGAGGAGGCGACGAACAAGGCGGTGGCGCGCCA
TCTGGAGCAGGTCCCGACGAGGAAGTTCGCCAACCTGATGAACCAGTTGACGTCGCGGCTTCAGAACCAGGACAC
CACTTTCCAGAGGCTGCTCTTCGACCTGGTCCTGAGGATCTGCACTGACCACCCGTACCACGGAATGTACCAGAT
CTGGTCGGGGATGAAGGCCAAAGCCCAACAGAAGGACGAGGTGGCTGCCCTCCGCGTGAAGGCGACGGAAAAGGT
CGCCCAGCGGCTGGCTGGCATCAAGGACGTGGCCCAGATCTGGTTGTCCATCGACAAGACGAGCAAGTACTATCA
CGGGCTCGCCGTCGATAGAAACACGTCCAAGTACAAGTCCGGCGCCAAGCTTCCCCTGAAGGAGTGTGCGGCCGG
GCAGAATCTGATGATCTACTTGGCCCGGTACAAGATTCCGCCGCCGACCATGCACATTGAGGTTTCGGCCGCCCG
AGACTACTCGGGCGTGCCGCATGTCGTGAAGCTGGAGCCTACGATGACGATAGCATCCGGCCTCAGCGCGCCCAA
GATCATCACGGCCGTGGGCAGCGACGGAAAGAAGTACAAGCAGCTGGTCAAGGGCGGCCACGACGACCTGCGGCA
GGACGCCATCATGGAGCAAGTCTTTGCTGCCGTCTCGTCGCTTCTGAAGCTACACCGAAGCTCCCAGCAGAGGAA
TCTGGGGATTCGAACATACAAGGTCCTCCCGCTCACCGCGTCGTCTGGCCTGATCGAGTTTGTCCCGAACACGAT
CCCACTGCACGACTTTCTCATGCCAGCGCACGAGCGGTACCATCCCAGGGATCTGAAGGGATCGCAGTGCCGGAA
GGAGATTATGAATGTGCAGAGCCGGCCGGTGGAAACACGGATCAGCACTTATCGCAAGGTGACGGAGAAGTTTCA
CCCGGTCATGAGATACTTCTTCATGGAATACTTCATGGACCCGGACGAATGGTTCACCAAGCGGCTGGCATACAC
AAGAAGCACGGCAGCGATATCAATACTCGGGCACGTGCTCGGCTTGGGGGACCGACATGGACACAACATCCTGCT
GGATACCAAGACTGGCGAGGCGGTACACATCGACCTGGGCGTGGCGTTCGAGGCGGGACGGATCCTGCCAGTGCC
CGAGCTGGTGCCGTTTCGGCTCACGCGAGACATTGTGGACGGGATGGGAATCACAAAGACGGAGGGCGTGTTTCG
CCGCTGCTGCGAGTTCACCTTGGATGCCCTCCGGGAGGAGCAGTACTCGATCATGACAGTCTTGGACGTGCTGCG
CTACGACCCGCTGTACACCTGGTCCATCTCGCCGGTCAGGCTGGCCAAGCTGCAGAAGGCAAGACAGGAGGGTGA
GGCGGGAGCCGACGATTCGGAGCAGGGCGAGACCGAGGCCAAGCGGGCGCGGAAGGCGGCGGGCCACTTCAACGA
ACCGTCCGAGGCGGACCGAGCGCTGGAGGTGGTGAGGAAGAAGCTTTCCAAGACGCTCAGCGTGACGGCAACGGT
CAACGACCTCATTAACCAGGCGACGGACGAGCGAAACCTGGCGGTTCTGTACTCTGGTGGGTGCCGCGCCCTCTC
CCAGTCTTGGAAAGCAAGCGCCTTGTGCGTGGACTGACTGACGATGTGTGCTTTTTGCAGGGTGGGCAGCGTATG
CCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail