Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2926
Gene name
LocationContig_173:16740..18449
Strand+
Gene length (bp)1709
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11640 TAN Telomere-length maintenance and DNA damage repair 6.2E-47 10 154

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 4 508 0.0E+00
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 45 507 3.0E-81
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 16 507 1.0E-28
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 43 507 4.0E-25
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 43 507 1.0E-24

GO

GO Term Description Terminal node
GO:0004674 protein serine/threonine kinase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0016301 kinase activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0004672 protein kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2926
MASIQTSTVKHLARDIKSGSLKDREKAVDDLTHVLRNRAANLNALEDKGYHEIFEAIFSLVLSEKPVFCDKKKTQ
AKRNGAASRLSKCAAAIRVTAARGSPKLGRKTLLALIDHITQVLPGPNDDFVPPLVQDYVKTLAEVLGRPSHVEL
LARKGAAPWQRCVDFLLDLAEYSLPSESQSGPPPLSRDSPAPTISTPWSTGRNSYVSTQSQKRSHVLEGGPLRDA
LVGLHQLVQGANAPVITRSQDVTSLVLRVLGMKHLSLGSMQTVCFAIVNSVFASTQADEFAWANALVHSLLPLMS
YWWRADKVSQDELIKALRNEISRTIFLTHLHIEHLAVTVGDVTARDHVEALLEPLWLEYSKRGEAFRLQLHDLTF
CTSLLTQDSLRLDLFGLRPHNIEGEGSWALVQNLALLEAILLRPDKNQAGTGGDNIDQPSKRRRLREGSARLRLK
LKSKDVGTQRTALQLVPFLVAKDVWPREDVADLFVELVHSASDKNTVTASWALIACAR*
Coding >Hirsu2|2926
ATGGCGTCCATTCAAACCTCGACTGTGAAACATCTCGCCAGGGACATCAAGTCCGGCTCTTTGAAGGACCGCGAG
AAGGCTGTAGATGATTTGACTCATGTGCTGAGAAACAGAGCTGCAAACCTCAATGCACTGGAGGACAAGGGATAC
CATGAGATCTTCGAGGCGATATTCAGTCTCGTCCTCAGCGAGAAGCCGGTCTTCTGTGACAAGAAGAAGACCCAG
GCAAAGCGCAACGGCGCTGCCTCGCGCCTTTCGAAATGTGCCGCTGCCATCCGAGTCACTGCCGCCCGGGGCTCT
CCCAAGCTGGGACGGAAGACGTTGCTGGCCCTCATAGATCACATAACGCAGGTCCTTCCCGGACCGAACGATGAT
TTTGTACCGCCCTTGGTCCAGGACTATGTCAAGACGTTGGCCGAGGTGCTCGGCCGCCCGTCGCACGTCGAATTG
CTCGCCAGGAAGGGCGCTGCGCCCTGGCAGAGGTGTGTCGACTTCTTGCTCGATCTCGCCGAGTATAGTCTGCCC
AGCGAATCTCAATCAGGTCCACCGCCTCTGAGCCGGGACTCGCCCGCCCCTACAATTTCCACGCCCTGGTCGACG
GGAAGGAACTCGTATGTTTCGACTCAGAGTCAGAAGCGCTCCCACGTCTTGGAGGGAGGCCCTCTTCGAGATGCT
CTGGTAGGCTTGCACCAGCTCGTGCAAGGGGCCAATGCTCCTGTCATAACGAGGTCCCAGGATGTCACGAGCCTG
GTCCTGAGGGTACTGGGGATGAAGCACCTCAGCCTAGGATCCATGCAGACAGTCTGCTTCGCAATTGTCAACAGC
GTATTTGCTTCGACCCAGGCCGACGAGTTTGCGTGGGCCAATGCTCTTGTGCACAGCCTTCTGCCTTTGATGAGC
TACTGGTGGCGTGCCGACAAGGTTTCCCAAGATGAGCTCATAAAAGCGTTGAGAAACGAGATATCGAGAACCATC
TTTCTCACACATCTGCACATCGAGCATTTGGCCGTCACTGTTGGGGACGTGACGGCGCGAGATCATGTGGAGGCC
CTCCTTGAGCCCTTGTGGCTCGAGTACTCGAAGCGAGGCGAGGCATTTCGACTGCAGCTCCACGACCTGACCTTC
TGCACCTCCTTATTGACCCAGGACTCTCTCCGACTAGATCTTTTCGGACTCCGTCCCCACAACATCGAAGGAGAA
GGTTCGTGGGCATTAGTCCAGAACCTGGCCCTGCTGGAGGCAATCCTACTGCGGCCTGATAAGAATCAAGCTGGC
ACCGGCGGCGATAACATCGACCAGCCGTCTAAGCGGCGAAGGTTGCGGGAGGGTTCGGCACGCCTAAGGCTCAAG
CTGAAGTCGAAAGACGTTGGTACTCAGAGGACAGCTCTTCAGCTGGTTCCATTTCTCGTCGCCAAGGACGTTTGG
CCAAGAGAGGACGTCGCGGACCTGTTCGTGGAATTAGTGCATTCAGCCTCGGACAAGAACACTGTCACGGCCTCC
TGGGCTCTTATCGCTTGTGCTAGGTAG
Transcript >Hirsu2|2926
ATGGCGTCCATTCAAACCTCGACTGTGAAACATCTCGCCAGGGACATCAAGTCCGGCTCTTTGAAGGACCGCGAG
AAGGCTGTAGATGATTTGACTCATGTGCTGAGAAACAGAGCTGCAAACCTCAATGCACTGGAGGACAAGGGATAC
CATGAGATCTTCGAGGCGATATTCAGTCTCGTCCTCAGCGAGAAGCCGGTCTTCTGTGACAAGAAGAAGACCCAG
GCAAAGCGCAACGGCGCTGCCTCGCGCCTTTCGAAATGTGCCGCTGCCATCCGAGTCACTGCCGCCCGGGGCTCT
CCCAAGCTGGGACGGAAGACGTTGCTGGCCCTCATAGATCACATAACGCAGGTCCTTCCCGGACCGAACGATGAT
TTTGTACCGCCCTTGGTCCAGGACTATGTCAAGACGTTGGCCGAGGTGCTCGGCCGCCCGTCGCACGTCGAATTG
CTCGCCAGGAAGGGCGCTGCGCCCTGGCAGAGGTGTGTCGACTTCTTGCTCGATCTCGCCGAGTATAGTCTGCCC
AGCGAATCTCAATCAGGTCCACCGCCTCTGAGCCGGGACTCGCCCGCCCCTACAATTTCCACGCCCTGGTCGACG
GGAAGGAACTCGTATGTTTCGACTCAGAGTCAGAAGCGCTCCCACGTCTTGGAGGGAGGCCCTCTTCGAGATGCT
CTGGTAGGCTTGCACCAGCTCGTGCAAGGGGCCAATGCTCCTGTCATAACGAGGTCCCAGGATGTCACGAGCCTG
GTCCTGAGGGTACTGGGGATGAAGCACCTCAGCCTAGGATCCATGCAGACAGTCTGCTTCGCAATTGTCAACAGC
GTATTTGCTTCGACCCAGGCCGACGAGTTTGCGTGGGCCAATGCTCTTGTGCACAGCCTTCTGCCTTTGATGAGC
TACTGGTGGCGTGCCGACAAGGTTTCCCAAGATGAGCTCATAAAAGCGTTGAGAAACGAGATATCGAGAACCATC
TTTCTCACACATCTGCACATCGAGCATTTGGCCGTCACTGTTGGGGACGTGACGGCGCGAGATCATGTGGAGGCC
CTCCTTGAGCCCTTGTGGCTCGAGTACTCGAAGCGAGGCGAGGCATTTCGACTGCAGCTCCACGACCTGACCTTC
TGCACCTCCTTATTGACCCAGGACTCTCTCCGACTAGATCTTTTCGGACTCCGTCCCCACAACATCGAAGGAGAA
GGTTCGTGGGCATTAGTCCAGAACCTGGCCCTGCTGGAGGCAATCCTACTGCGGCCTGATAAGAATCAAGCTGGC
ACCGGCGGCGATAACATCGACCAGCCGTCTAAGCGGCGAAGGTTGCGGGAGGGTTCGGCACGCCTAAGGCTCAAG
CTGAAGTCGAAAGACGTTGGTACTCAGAGGACAGCTCTTCAGCTGGTTCCATTTCTCGTCGCCAAGGACGTTTGG
CCAAGAGAGGACGTCGCGGACCTGTTCGTGGAATTAGTGCATTCAGCCTCGGACAAGAACACTGTCACGGCCTCC
TGGGCTCTTATCGCTTGTGCTAGGTAG
Gene >Hirsu2|2926
ATGGCGTCCATTCAAACCTCGACTGTGAAACATCTCGCCAGTATGCACAGCCTTCTTGTGCGGACTTCGGATGAA
GCTGATCGCTTGCAGGGGACATCAAGTCCGGCTCTTTGAAGGACCGCGAGAAGGCTGTAGATGGTGCGCAAAGCC
TCTGCTTTTTCGCGCAAAGAGACGGCGCTCACCAGAAAGAAATACGCTAGATTTGACTCATGTGCTGAGAAACAG
AGCTGCAAACCTGTGCGTCCGACCTTCTGGACCGCTTTTGAAGTCGACACGCGGGTTGCGCTGACTTGACTGCTC
CTCTCAGCAATGCACTGGAGGACAAGGGATACCATGAGATCTTCGAGGCGATATTCAGTCTCGTCCTCAGCGAGA
AGCCGGTCTTCTGTGACAAGAAGAAGACCCAGGCAAAGCGCAACGGCGCTGCCTCGCGCCTTTCGAAATGTGCCG
CTGCCATCCGAGTCACTGCCGCCCGGGGCTCTCCCAAGCTGGGACGGAAGACGTTGCTGGCCCTCATAGATCACA
TAACGCAGGTCCTTCCCGGACCGAACGATGATTTTGTACCGCCCTTGGTCCAGGACTATGTCAAGACGTTGGCCG
AGGTGCTCGGCCGCCCGTCGCACGTCGAATTGCTCGCCAGGAAGGGCGCTGCGCCCTGGCAGAGGTGTGTCGACT
TCTTGCTCGATCTCGCCGAGTATAGTCTGCCCAGCGAATCTCAATCAGGTCCACCGCCTCTGAGCCGGGACTCGC
CCGCCCCTACAATTTCCACGCCCTGGTCGACGGGAAGGAACTCGTATGTTTCGACTCAGAGTCAGAAGCGCTCCC
ACGTCTTGGAGGGAGGCCCTCTTCGAGATGCTCTGGTAGGCTTGCACCAGCTCGTGCAAGGGGCCAATGCTCCTG
TCATAACGAGGTCCCAGGATGTCACGAGCCTGGTCCTGAGGGTACTGGGGATGAAGCACCTCAGCCTAGGATCCA
TGCAGACAGTCTGCTTCGCAATTGTCAACAGCGTATTTGCTTCGACCCAGGCCGACGAGTTTGCGTGGGCCAATG
CTCTTGTGCACAGCCTTCTGCCTTTGATGAGCTACTGGTGGCGTGCCGACAAGGTTTCCCAAGATGAGCTCATAA
AAGCGTTGAGAAACGAGATATCGAGAACCATCTTTCTCACACATCTGCACATCGAGCATTTGGCCGTCACTGTTG
GGGACGTGACGGCGCGAGATCATGTGGAGGCCCTCCTTGAGCCCTTGTGGCTCGAGTACTCGAAGCGAGGCGAGG
CATTTCGACTGCAGCTCCACGACCTGACCTTCTGCACCTCCTTATTGACCCAGGACTCTCTCCGACTAGATCTTT
TCGGACTCCGTCCCCACAACATCGAAGGAGAAGGTTCGTGGGCATTAGTCCAGAACCTGGCCCTGCTGGAGGCAA
TCCTACTGCGGCCTGATAAGAATCAAGCTGGCACCGGCGGCGATAACATCGACCAGCCGTCTAAGCGGCGAAGGT
TGCGGGAGGGTTCGGCACGCCTAAGGCTCAAGCTGAAGTCGAAAGACGTTGGTACTCAGAGGACAGCTCTTCAGC
TGGTTCCATTTCTCGTCGCCAAGGACGTTTGGCCAAGAGAGGACGTCGCGGACCTGTTCGTGGAATTAGTGCATT
CAGCCTCGGACAAGAACACTGTCACGGCCTCCTGGGCTCTTATCGCTTGTGCTAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail