Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2923
Gene name
LocationContig_173:9227..10201
Strand+
Gene length (bp)974
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 4.9E-10 215 262
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.7E-07 216 257
PF13639 zf-RING_2 Ring finger domain 1.2E-06 216 258
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.6E-06 217 257
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 2.3E-06 217 264
PF13445 zf-RING_UBOX RING-type zinc-finger 2.2E-05 217 255
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 7.1E-05 216 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 198 261 2.0E-09
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 194 261 7.0E-09
sp|Q99942|RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1 199 261 1.0E-08
sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 199 261 1.0E-08
sp|O35445|RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1 199 261 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 198 261 2.0E-09
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 194 261 7.0E-09
sp|Q99942|RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1 199 261 1.0E-08
sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 199 261 1.0E-08
sp|O35445|RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1 199 261 1.0E-08
sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 213 261 4.0E-08
sp|Q5ZIR9|RN185_CHICK E3 ubiquitin-protein ligase RNF185 OS=Gallus gallus GN=RNF185 PE=2 SV=1 207 268 4.0E-08
sp|P87176|SLX8_SCHPO E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slx8 PE=1 SV=1 196 261 4.0E-08
sp|Q96GF1|RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens GN=RNF185 PE=1 SV=1 213 268 4.0E-08
sp|Q568Y3|RN185_RAT E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1 213 268 5.0E-08
sp|Q5RFK9|RN185_PONAB E3 ubiquitin-protein ligase RNF185 OS=Pongo abelii GN=RNF185 PE=2 SV=1 213 268 7.0E-08
sp|Q6PC78|RN185_DANRE E3 ubiquitin-protein ligase RNF185 OS=Danio rerio GN=rnf185 PE=2 SV=1 213 268 2.0E-07
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 216 261 4.0E-07
sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 213 275 3.0E-06
sp|Q8GUK7|RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana GN=RMA3 PE=1 SV=1 194 265 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0005680 anaphase-promoting complex Yes
GO:0046872 metal ion binding Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0019787 ubiquitin-like protein transferase activity No
GO:1902494 catalytic complex No
GO:0044422 organelle part No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0044428 nuclear part No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No
GO:0003824 catalytic activity No
GO:0044424 intracellular part No
GO:1990234 transferase complex No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0032991 protein-containing complex No
GO:0043167 ion binding No
GO:0000151 ubiquitin ligase complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2923
MPSWRLESDVDITDDWLDDTPDSVSFVTPEEPSHDSTTLDDEFVSALAENDYSSPSSYPSFLSPDQASDQQQQQQ
PPPRASAPDLGSHASRSFALAGLVNNTPSRSTARSALPPLANSLGHRPSPIGSAPYAAAEMPPYSHDELPQPKRR
RLSTAGALNRLILPLPSDDDDLFGDKLEDAPASDGLTTIDLTEANEVPEELKKPPVDNRIKISAFQCAICMDDVT
TLTVTHCGHLYCQQCLHSSLHVDSTRGKCPMCRAKIDMKSRGSYTSKTKGFWPLELKLMTTNKKGKRKADAKP*
Coding >Hirsu2|2923
ATGCCGTCCTGGCGCCTCGAGAGCGACGTCGACATCACCGACGACTGGCTCGACGACACCCCCGATAGCGTCTCC
TTCGTCACGCCCGAAGAACCCTCCCACGACTCTACTACCCTCGACGACGAATTCGTGAGCGCCCTCGCCGAAAAC
GACTACTCGTCTCCCTCGAGCTACCCGTCCTTCCTGAGCCCCGACCAGGCCTCAGATCAACAACAACAACAACAA
CCTCCCCCGCGGGCCTCGGCGCCGGACCTCGGGTCCCATGCCAGCCGATCCTTTGCCCTCGCCGGACTCGTCAAC
AACACGCCTTCGCGCTCGACGGCCCGCTCGGCCCTCCCGCCGCTGGCAAACAGCCTCGGCCACCGGCCTTCCCCG
ATCGGCTCCGCACCGTACGCCGCCGCCGAAATGCCGCCCTACAGCCATGACGAGCTTCCTCAGCCGAAGCGGCGG
CGCCTGTCGACAGCCGGAGCACTCAACCGCCTGATTCTGCCCCTGCCGTCGGACGACGACGACCTGTTCGGCGAC
AAGCTCGAAGACGCACCCGCCTCGGATGGGCTGACCACCATCGACCTGACCGAGGCCAACGAGGTGCCAGAGGAA
CTCAAGAAGCCGCCGGTCGACAACCGCATCAAGATCTCCGCCTTCCAGTGCGCCATCTGCATGGACGACGTCACC
ACCCTGACCGTCACCCATTGTGGCCACCTGTACTGCCAACAATGTCTTCACTCGTCGCTGCACGTCGACTCCACG
AGGGGTAAATGCCCCATGTGCCGCGCCAAGATAGACATGAAGTCTCGCGGCAGCTACACATCCAAGACCAAGGGC
TTCTGGCCCCTCGAGCTGAAGCTCATGACGACGAACAAGAAGGGCAAGCGCAAAGCAGACGCCAAGCCCTGA
Transcript >Hirsu2|2923
ATGCCGTCCTGGCGCCTCGAGAGCGACGTCGACATCACCGACGACTGGCTCGACGACACCCCCGATAGCGTCTCC
TTCGTCACGCCCGAAGAACCCTCCCACGACTCTACTACCCTCGACGACGAATTCGTGAGCGCCCTCGCCGAAAAC
GACTACTCGTCTCCCTCGAGCTACCCGTCCTTCCTGAGCCCCGACCAGGCCTCAGATCAACAACAACAACAACAA
CCTCCCCCGCGGGCCTCGGCGCCGGACCTCGGGTCCCATGCCAGCCGATCCTTTGCCCTCGCCGGACTCGTCAAC
AACACGCCTTCGCGCTCGACGGCCCGCTCGGCCCTCCCGCCGCTGGCAAACAGCCTCGGCCACCGGCCTTCCCCG
ATCGGCTCCGCACCGTACGCCGCCGCCGAAATGCCGCCCTACAGCCATGACGAGCTTCCTCAGCCGAAGCGGCGG
CGCCTGTCGACAGCCGGAGCACTCAACCGCCTGATTCTGCCCCTGCCGTCGGACGACGACGACCTGTTCGGCGAC
AAGCTCGAAGACGCACCCGCCTCGGATGGGCTGACCACCATCGACCTGACCGAGGCCAACGAGGTGCCAGAGGAA
CTCAAGAAGCCGCCGGTCGACAACCGCATCAAGATCTCCGCCTTCCAGTGCGCCATCTGCATGGACGACGTCACC
ACCCTGACCGTCACCCATTGTGGCCACCTGTACTGCCAACAATGTCTTCACTCGTCGCTGCACGTCGACTCCACG
AGGGGTAAATGCCCCATGTGCCGCGCCAAGATAGACATGAAGTCTCGCGGCAGCTACACATCCAAGACCAAGGGC
TTCTGGCCCCTCGAGCTGAAGCTCATGACGACGAACAAGAAGGGCAAGCGCAAAGCAGACGCCAAGCCCTGA
Gene >Hirsu2|2923
ATGCCGTCCTGGCGCCTCGAGAGCGACGTCGACATCACCGACGACTGGCTCGACGACACCCCCGATAGCGTCTCC
TTCGTCACGCCCGAAGAACCCTCCCACGACTCTACTACCCTCGACGACGAATTCGTGAGCGCCCTCGCCGAAAAC
GACTACTCGTCTCCCTCGAGCTACCCGTCCTTCCTGAGCCCCGACCAGGCCTCAGATCAACAACAACAACAACAA
CCTCCCCCGCGGGCCTCGGCGCCGGACCTCGGGTCCCATGCCAGCCGATCCTTTGCCCTCGCCGGACTCGTCAAC
AACACGCCTTCGCGCTCGACGGCCCGCTCGGCCCTCCCGCCGCTGGCAAACAGCCTCGGCCACCGGCCTTCCCCG
ATCGGCTCCGCACCGTACGCCGCCGCCGAAATGCCGCCCTACAGCCATGACGAGCTTCCTCAGCCGAAGCGGCGG
CGCCTGTCGACAGCCGGAGCACTCAACCGCCTGATTCTGCCCCTGCCGTCGGACGACGACGACCTGTTCGGCGAC
AAGCTCGAAGACGCACCCGCCTCGGATGGGCTGACCACCATCGACCTGACCGAGGCCAACGAGGTGCCAGAGGAA
CTCAAGAAGCCGCCGGTCGACAACCGCATCAAGATCTCCGCCTTCCAGTGCGCCATCTGCATGGACGACGTCACC
ACCCTGACCGTCACCCATTGTGGTGCGATGCCCCTTCGTTGCCGCTCCTCTCCCTCCCCTGCCCGTGCCTGCTGC
TGACGCCGTCGCCGACCATAAAAGGCCACCTGTACTGCCAACAATGTCTTCACTCGTCGCTGCACGTCGACTCCA
CGAGGGGTAAATGCCCCATGTGCCGCGCCAAGATAGACATGAAGTCTCGCGGCAGCTACACATCCAAGACCAAGG
GCTTCTGGCCCCTCGAGCTGAAGCTCATGACGACGAACAAGAAGGGCAAGCGCAAAGCAGACGCCAAGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail