Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2914
Gene name
LocationContig_1727:36..1032
Strand+
Gene length (bp)996
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01300 Sua5_yciO_yrdC Telomere recombination 3.6E-34 10 122
PF03481 SUA5 Putative GTP-binding controlling metal-binding 4.6E-31 128 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94530|SUA5_SCHPO Threonylcarbamoyl-AMP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sua5 PE=3 SV=1 3 327 1.0E-68
sp|P32579|SUA5_YEAST Threonylcarbamoyl-AMP synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUA5 PE=1 SV=1 4 329 1.0E-59
sp|P39153|SUA5_BACSU Threonylcarbamoyl-AMP synthase OS=Bacillus subtilis (strain 168) GN=ywlC PE=1 SV=1 5 175 9.0E-43
sp|Q970S6|SUA5_SULTO Threonylcarbamoyl-AMP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=sua5 PE=1 SV=1 16 173 3.0E-42
sp|Q9UYB2|SUA5_PYRAB Threonylcarbamoyl-AMP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=sua5 PE=1 SV=1 11 176 8.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94530|SUA5_SCHPO Threonylcarbamoyl-AMP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sua5 PE=3 SV=1 3 327 1.0E-68
sp|P32579|SUA5_YEAST Threonylcarbamoyl-AMP synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUA5 PE=1 SV=1 4 329 1.0E-59
sp|P39153|SUA5_BACSU Threonylcarbamoyl-AMP synthase OS=Bacillus subtilis (strain 168) GN=ywlC PE=1 SV=1 5 175 9.0E-43
sp|Q970S6|SUA5_SULTO Threonylcarbamoyl-AMP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=sua5 PE=1 SV=1 16 173 3.0E-42
sp|Q9UYB2|SUA5_PYRAB Threonylcarbamoyl-AMP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=sua5 PE=1 SV=1 11 176 8.0E-40
sp|P9WGC9|TSAC_MYCTU Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1301 PE=1 SV=1 4 137 4.0E-12
sp|P9WGC8|TSAC_MYCTO Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1340 PE=3 SV=1 4 137 4.0E-12
sp|Q60369|TSAC_METJA Putative threonylcarbamoyl-AMP synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0062 PE=3 SV=1 9 132 3.0E-10
sp|Q0VTD8|TSAC_ALCBS Threonylcarbamoyl-AMP synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tsaC PE=3 SV=1 12 121 5.0E-08
sp|Q499R4|YRDC_RAT YrdC domain-containing protein, mitochondrial OS=Rattus norvegicus GN=Yrdc PE=2 SV=1 9 110 8.0E-07
sp|P45831|TSAC_MYCLE Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium leprae (strain TN) GN=ML1136 PE=3 SV=1 9 126 2.0E-06
sp|Q3U5F4|YRDC_MOUSE YrdC domain-containing protein, mitochondrial OS=Mus musculus GN=Yrdc PE=1 SV=1 9 110 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003725 double-stranded RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003723 RNA binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2914
LPLLPAIYRPLIERFWPGPLTILLRNPTPSRLAPEVTAGLATFGVRMPSSPLALTLIKLAGVPLAAPSANASTRP
SPTTAQHVRDDLDGRIELILDGGPCRVGLESTVVDGLCDPPAVLRPGGVGLDELRACPGWEAVVRAYKDRSEEGK
AAPRAPGMKYKHYSPRARVVLYEASRHEAADGILPSDVEGARAVAANGDPSRANGHGRRSLGIIRTKRWKPGAGL
NCDNLRPAPPWRGTDDQGGHLERLPETACEVLVGDLRDRDGEVIAQVYDLGLGTDTRAIAQGLFSALRELDRRGA
DTIFVDGIDGELDMAAAVMNRLRKAASETRA*
Coding >Hirsu2|2914
CTGCCGCTGCTGCCGGCCATCTACCGGCCGCTGATCGAGCGCTTCTGGCCCGGCCCACTGACGATTCTGCTGCGC
AACCCGACGCCGTCGCGGCTGGCGCCCGAGGTGACGGCCGGGCTCGCGACGTTCGGCGTGCGGATGCCGTCGTCG
CCGCTGGCCCTGACGCTCATCAAGCTGGCCGGGGTGCCGCTCGCGGCGCCGTCGGCCAATGCGTCGACGCGGCCG
TCGCCGACGACGGCCCAGCACGTCCGCGACGACCTGGACGGCCGCATCGAGCTCATCCTCGACGGCGGGCCGTGC
CGCGTCGGCCTCGAGAGCACCGTCGTCGACGGCCTGTGCGACCCCCCCGCCGTGCTGCGGCCCGGCGGCGTCGGC
CTCGACGAGCTGCGGGCCTGCCCCGGCTGGGAGGCCGTCGTTCGCGCCTACAAGGACCGCAGCGAGGAGGGCAAG
GCCGCCCCGCGCGCGCCCGGCATGAAATACAAGCACTACAGCCCCCGGGCCAGGGTCGTCCTGTACGAGGCCTCG
AGGCACGAGGCGGCCGACGGCATCCTGCCGTCCGACGTCGAAGGCGCGCGGGCCGTCGCCGCCAACGGGGACCCG
TCCCGGGCGAACGGCCACGGGCGGAGGAGCCTCGGCATCATCCGCACCAAGCGCTGGAAGCCCGGCGCCGGGCTC
AACTGCGATAACCTGCGACCTGCCCCGCCGTGGCGCGGCACGGACGACCAGGGAGGGCACCTTGAACGGCTGCCG
GAGACGGCATGCGAGGTCTTGGTCGGCGACCTCAGGGACCGGGACGGAGAGGTCATTGCCCAGGTCTACGACCTG
GGCTTGGGGACGGACACGAGGGCCATCGCGCAAGGCTTGTTCTCGGCTCTGCGCGAACTCGACCGGCGCGGTGCG
GACACGATTTTTGTAGACGGTATAGACGGCGAGCTCGACATGGCCGCGGCGGTCATGAACCGCCTCCGCAAGGCG
GCCTCGGAGACTAGAGCATGA
Transcript >Hirsu2|2914
CTGCCGCTGCTGCCGGCCATCTACCGGCCGCTGATCGAGCGCTTCTGGCCCGGCCCACTGACGATTCTGCTGCGC
AACCCGACGCCGTCGCGGCTGGCGCCCGAGGTGACGGCCGGGCTCGCGACGTTCGGCGTGCGGATGCCGTCGTCG
CCGCTGGCCCTGACGCTCATCAAGCTGGCCGGGGTGCCGCTCGCGGCGCCGTCGGCCAATGCGTCGACGCGGCCG
TCGCCGACGACGGCCCAGCACGTCCGCGACGACCTGGACGGCCGCATCGAGCTCATCCTCGACGGCGGGCCGTGC
CGCGTCGGCCTCGAGAGCACCGTCGTCGACGGCCTGTGCGACCCCCCCGCCGTGCTGCGGCCCGGCGGCGTCGGC
CTCGACGAGCTGCGGGCCTGCCCCGGCTGGGAGGCCGTCGTTCGCGCCTACAAGGACCGCAGCGAGGAGGGCAAG
GCCGCCCCGCGCGCGCCCGGCATGAAATACAAGCACTACAGCCCCCGGGCCAGGGTCGTCCTGTACGAGGCCTCG
AGGCACGAGGCGGCCGACGGCATCCTGCCGTCCGACGTCGAAGGCGCGCGGGCCGTCGCCGCCAACGGGGACCCG
TCCCGGGCGAACGGCCACGGGCGGAGGAGCCTCGGCATCATCCGCACCAAGCGCTGGAAGCCCGGCGCCGGGCTC
AACTGCGATAACCTGCGACCTGCCCCGCCGTGGCGCGGCACGGACGACCAGGGAGGGCACCTTGAACGGCTGCCG
GAGACGGCATGCGAGGTCTTGGTCGGCGACCTCAGGGACCGGGACGGAGAGGTCATTGCCCAGGTCTACGACCTG
GGCTTGGGGACGGACACGAGGGCCATCGCGCAAGGCTTGTTCTCGGCTCTGCGCGAACTCGACCGGCGCGGTGCG
GACACGATTTTTGTAGACGGTATAGACGGCGAGCTCGACATGGCCGCGGCGGTCATGAACCGCCTCCGCAAGGCG
GCCTCGGAGACTAGAGCATGA
Gene >Hirsu2|2914
CTGCCGCTGCTGCCGGCCATCTACCGGCCGCTGATCGAGCGCTTCTGGCCCGGCCCACTGACGATTCTGCTGCGC
AACCCGACGCCGTCGCGGCTGGCGCCCGAGGTGACGGCCGGGCTCGCGACGTTCGGCGTGCGGATGCCGTCGTCG
CCGCTGGCCCTGACGCTCATCAAGCTGGCCGGGGTGCCGCTCGCGGCGCCGTCGGCCAATGCGTCGACGCGGCCG
TCGCCGACGACGGCCCAGCACGTCCGCGACGACCTGGACGGCCGCATCGAGCTCATCCTCGACGGCGGGCCGTGC
CGCGTCGGCCTCGAGAGCACCGTCGTCGACGGCCTGTGCGACCCCCCCGCCGTGCTGCGGCCCGGCGGCGTCGGC
CTCGACGAGCTGCGGGCCTGCCCCGGCTGGGAGGCCGTCGTTCGCGCCTACAAGGACCGCAGCGAGGAGGGCAAG
GCCGCCCCGCGCGCGCCCGGCATGAAATACAAGCACTACAGCCCCCGGGCCAGGGTCGTCCTGTACGAGGCCTCG
AGGCACGAGGCGGCCGACGGCATCCTGCCGTCCGACGTCGAAGGCGCGCGGGCCGTCGCCGCCAACGGGGACCCG
TCCCGGGCGAACGGCCACGGGCGGAGGAGCCTCGGCATCATCCGCACCAAGCGCTGGAAGCCCGGCGCCGGGCTC
AACTGCGATAACCTGCGACCTGCCCCGCCGTGGCGCGGCACGGACGACCAGGGAGGGCACCTTGAACGGCTGCCG
GAGACGGCATGCGAGGTCTTGGTCGGCGACCTCAGGGACCGGGACGGAGAGGTCATTGCCCAGGTCTACGACCTG
GGCTTGGGGACGGACACGAGGGCCATCGCGCAAGGCTTGTTCTCGGCTCTGCGCGAACTCGACCGGCGCGGTGCG
GACACGATTTTTGTAGACGGTATAGACGGCGAGCTCGACATGGCCGCGGCGGTCATGAACCGCCTCCGCAAGGCG
GCCTCGGAGACTAGAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail