Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2912
Gene name
LocationContig_1726:1675..2539
Strand+
Gene length (bp)864
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08294 TIM21 TIM21 3.9E-43 56 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ95|TIM21_GIBZE Mitochondrial import inner membrane translocase subunit TIM21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM21 PE=3 SV=1 17 218 1.0E-94
sp|Q7S8S5|TIM21_NEUCR Mitochondrial import inner membrane translocase subunit tim21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim21 PE=3 SV=1 19 218 5.0E-83
sp|Q4X1I8|TIM21_ASPFU Mitochondrial import inner membrane translocase subunit tim21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim21 PE=3 SV=1 18 218 2.0E-58
sp|Q6CAQ9|TIM21_YARLI Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1 50 219 3.0E-22
sp|P53220|TIM21_YEAST Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM21 PE=1 SV=1 68 219 9.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ95|TIM21_GIBZE Mitochondrial import inner membrane translocase subunit TIM21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM21 PE=3 SV=1 17 218 1.0E-94
sp|Q7S8S5|TIM21_NEUCR Mitochondrial import inner membrane translocase subunit tim21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim21 PE=3 SV=1 19 218 5.0E-83
sp|Q4X1I8|TIM21_ASPFU Mitochondrial import inner membrane translocase subunit tim21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim21 PE=3 SV=1 18 218 2.0E-58
sp|Q6CAQ9|TIM21_YARLI Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1 50 219 3.0E-22
sp|P53220|TIM21_YEAST Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM21 PE=1 SV=1 68 219 9.0E-22
sp|Q75CX4|TIM21_ASHGO Mitochondrial import inner membrane translocase subunit TIM21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM21 PE=3 SV=1 68 219 4.0E-20
sp|Q6CW96|TIM21_KLULA Mitochondrial import inner membrane translocase subunit TIM21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM21 PE=3 SV=1 68 219 8.0E-20
sp|Q6BVK1|TIM21_DEBHA Mitochondrial import inner membrane translocase subunit TIM21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM21 PE=3 SV=2 55 219 3.0E-14
sp|O94618|TIM21_SCHPO Mitochondrial import inner membrane translocase subunit tim21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim21 PE=3 SV=1 40 197 8.0E-13
sp|Q59VW7|TIM21_CANAL Mitochondrial import inner membrane translocase subunit TIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM21 PE=3 SV=1 64 219 1.0E-11
sp|Q6FMZ2|TIM21_CANGA Mitochondrial import inner membrane translocase subunit TIM21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM21 PE=3 SV=1 82 219 1.0E-11
sp|Q3SZV6|TIM21_BOVIN Mitochondrial import inner membrane translocase subunit Tim21 OS=Bos taurus GN=TIMM21 PE=2 SV=1 51 197 3.0E-10
sp|Q5XKA2|TIM21_XENLA Mitochondrial import inner membrane translocase subunit Tim21 OS=Xenopus laevis GN=timm21 PE=2 SV=1 12 194 1.0E-09
sp|Q9BVV7|TIM21_HUMAN Mitochondrial import inner membrane translocase subunit Tim21 OS=Homo sapiens GN=TIMM21 PE=1 SV=1 46 194 3.0E-07
sp|Q5U2X7|TIM21_RAT Mitochondrial import inner membrane translocase subunit Tim21 OS=Rattus norvegicus GN=Timm21 PE=2 SV=1 4 198 1.0E-06
sp|Q1G3L1|TIM21_ARATH Probable mitochondrial import inner membrane translocase subunit TIM21 OS=Arabidopsis thaliana GN=TIM21 PE=1 SV=1 98 189 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Yes
GO:0030150 protein import into mitochondrial matrix Yes
GO:0044446 intracellular organelle part No
GO:0071702 organic substance transport No
GO:0034613 cellular protein localization No
GO:0070727 cellular macromolecule localization No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0051234 establishment of localization No
GO:0042886 amide transport No
GO:0072594 establishment of protein localization to organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0072655 establishment of protein localization to mitochondrion No
GO:0015031 protein transport No
GO:0055085 transmembrane transport No
GO:0051179 localization No
GO:0071806 protein transmembrane transport No
GO:0046907 intracellular transport No
GO:0033036 macromolecule localization No
GO:0006839 mitochondrial transport No
GO:0070585 protein localization to mitochondrion No
GO:0044455 mitochondrial membrane part No
GO:0044425 membrane part No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0008104 protein localization No
GO:0065002 intracellular protein transmembrane transport No
GO:0098798 mitochondrial protein complex No
GO:0006810 transport No
GO:0051641 cellular localization No
GO:0044743 protein transmembrane import into intracellular organelle No
GO:1990542 mitochondrial transmembrane transport No
GO:0008150 biological_process No
GO:0044422 organelle part No
GO:0044429 mitochondrial part No
GO:0033365 protein localization to organelle No
GO:0071705 nitrogen compound transport No
GO:0015833 peptide transport No
GO:0045184 establishment of protein localization No
GO:0006886 intracellular protein transport No
GO:0017038 protein import No
GO:0098796 membrane protein complex No
GO:0051649 establishment of localization in cell No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2912
MKSTGPLRALRRQRWQAARPYATTGLGAARPSRRRSVTPFNDDGVVPWNQLSAAEKAGRATQQSFNLGLMVLGVA
LTGTVGYFLWTDVFSPDSKIAHFNRAVDRIKKDARCVELLGEPGKITAHGEATFNKWRRARPVASSERTDAQGNE
HLMMHFHVDGPLEEGVAQLHLVKRRGESDYEYKYFFVDVRGHERVYLEKADAKPSSGKKQLSFLGVKWG*
Coding >Hirsu2|2912
ATGAAGTCGACGGGCCCGCTCCGGGCGCTGCGGCGGCAGCGGTGGCAGGCGGCGCGGCCGTACGCGACGACGGGG
CTGGGCGCGGCGCGGCCGAGCCGGCGGCGCAGCGTGACGCCCTTCAACGACGACGGCGTCGTCCCCTGGAACCAG
CTGTCGGCGGCGGAGAAGGCCGGGCGGGCGACGCAGCAGAGCTTCAACCTCGGCCTGATGGTGCTCGGCGTCGCG
CTGACGGGCACGGTCGGGTACTTCCTGTGGACGGACGTCTTCTCGCCCGACAGCAAGATCGCGCACTTCAACCGG
GCCGTGGACCGGATCAAGAAGGACGCGCGCTGCGTCGAGCTGCTGGGCGAGCCCGGCAAGATCACGGCCCACGGC
GAGGCGACCTTCAACAAGTGGCGACGCGCCCGCCCCGTTGCATCGTCGGAGCGCACCGACGCCCAGGGCAACGAG
CACCTCATGATGCATTTCCACGTCGACGGCCCGCTGGAGGAGGGCGTGGCGCAGCTGCACCTGGTGAAGCGACGG
GGCGAGAGCGACTACGAGTACAAATACTTCTTCGTCGACGTGCGCGGGCACGAGCGCGTCTACCTCGAGAAGGCG
GACGCGAAGCCGAGCTCGGGCAAGAAGCAGCTCAGCTTCCTGGGCGTCAAATGGGGCTGA
Transcript >Hirsu2|2912
ATGAAGTCGACGGGCCCGCTCCGGGCGCTGCGGCGGCAGCGGTGGCAGGCGGCGCGGCCGTACGCGACGACGGGG
CTGGGCGCGGCGCGGCCGAGCCGGCGGCGCAGCGTGACGCCCTTCAACGACGACGGCGTCGTCCCCTGGAACCAG
CTGTCGGCGGCGGAGAAGGCCGGGCGGGCGACGCAGCAGAGCTTCAACCTCGGCCTGATGGTGCTCGGCGTCGCG
CTGACGGGCACGGTCGGGTACTTCCTGTGGACGGACGTCTTCTCGCCCGACAGCAAGATCGCGCACTTCAACCGG
GCCGTGGACCGGATCAAGAAGGACGCGCGCTGCGTCGAGCTGCTGGGCGAGCCCGGCAAGATCACGGCCCACGGC
GAGGCGACCTTCAACAAGTGGCGACGCGCCCGCCCCGTTGCATCGTCGGAGCGCACCGACGCCCAGGGCAACGAG
CACCTCATGATGCATTTCCACGTCGACGGCCCGCTGGAGGAGGGCGTGGCGCAGCTGCACCTGGTGAAGCGACGG
GGCGAGAGCGACTACGAGTACAAATACTTCTTCGTCGACGTGCGCGGGCACGAGCGCGTCTACCTCGAGAAGGCG
GACGCGAAGCCGAGCTCGGGCAAGAAGCAGCTCAGCTTCCTGGGCGTCAAATGGGGCTGA
Gene >Hirsu2|2912
ATGAAGTCGACGGGCCCGCTCCGGGCGCTGCGGCGGCAGCGGTGGCAGGCGGCGCGGCCGTACGCGACGACGGGG
CTGGGCGCGGCGCGGCCGAGCCGGCGGCGCAGCGTGACGCCCTTCAACGACGACGGCGTCGTCCCCTGGAACCAG
CTGTCGGCGGCGGAGAAGGCCGGGCGGGCGACGCAGCAGAGCTTCAACCTCGGCCTGATGGTGCTCGGCGTCGCG
CTGACGGTACGCACGCCCCCGGCCCGCCCGCCCGCTGTCTGTCGCTGACCGCCCGCCCCGGCGCCAGGGCACGGT
CGGGTACTTCCTGTGGACGGACGTCTTCTCGCCCGACAGCAAGATCGCGCACTTCAACCGGGCCGTGGACCGGAT
CAAGAAGGACGCGCGCTGCGTCGAGCTGCTGGGCGAGCCCGGCAAGATCACGGCCCACGGCGAGGCGACCTTCAA
CAAGTGGCGACGCGCCCGCCCCGTTGCGTACGTTTTTTTTTTGGGGGGTTTTTTCGTTTCCCTGCGCACCACTAC
AGTGCATGATGGCGCCTGCTGACGGCTCGTCAGATCGTCGGAGCGCACCGACGCCCAGGGCAACGAGCACCTCAT
GATGCATTTCCACGTGAGCAAACCCCCTCGCCGAAATTCGTCCGCACACGGCGCTGAGGATGGGGGTCCCCCCAG
GTCGACGGCCCGCTGGAGGAGGGCGTGGCGCAGCTGCACCTGGTGAAGCGACGGGGCGAGAGCGACTACGAGTAC
AAATACTTCTTCGTCGACGTGCGCGGGCACGAGCGCGTCTACCTCGAGAAGGCGGACGCGAAGCCGAGCTCGGGC
AAGAAGCAGCTCAGCTTCCTGGGCGTCAAATGGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail