Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2906
Gene name
LocationContig_1722:750..3590
Strand-
Gene length (bp)2840
Transcript length (bp)2367
Coding sequence length (bp)2367
Protein length (aa) 789

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 6.4E-35 5 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 4 284 1.0E-50
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3 307 3.0E-47
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3 292 2.0E-43
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 9 295 5.0E-42
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 3 283 7.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 4 284 1.0E-50
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3 307 3.0E-47
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3 292 2.0E-43
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 9 295 5.0E-42
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 3 283 7.0E-42
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3 299 2.0E-41
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3 292 3.0E-41
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3 283 3.0E-41
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 3 283 8.0E-41
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3 292 9.0E-41
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 4 283 2.0E-40
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 3 283 2.0E-40
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 5 301 1.0E-39
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 6 314 6.0E-38
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 8 296 5.0E-37
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 8 301 6.0E-37
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 8 283 1.0E-36
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3 301 1.0E-36
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 7 328 2.0E-36
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 8 295 4.0E-36
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5 283 5.0E-36
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 5 298 8.0E-36
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5 301 2.0E-35
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 11 302 2.0E-35
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 302 3.0E-35
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 10 314 1.0E-34
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 11 299 1.0E-34
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 7 294 2.0E-34
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 10 303 2.0E-34
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 89 295 5.0E-34
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 308 6.0E-34
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 8 296 8.0E-34
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 63 283 8.0E-34
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 5 301 9.0E-34
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3 297 2.0E-33
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 86 295 2.0E-33
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 86 295 2.0E-33
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5 297 3.0E-33
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 298 3.0E-33
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5 292 7.0E-33
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 5 296 7.0E-33
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 8 294 1.0E-32
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 8 298 3.0E-32
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2 292 4.0E-32
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 5 292 5.0E-32
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 8 283 9.0E-32
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2 300 1.0E-31
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 92 299 2.0E-31
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2 283 9.0E-31
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 5 283 9.0E-31
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 5 292 1.0E-30
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 5 299 1.0E-30
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5 280 2.0E-30
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3 299 2.0E-30
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 92 283 2.0E-30
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 5 296 3.0E-30
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 8 303 6.0E-30
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 10 296 8.0E-30
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 10 346 8.0E-30
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 92 298 8.0E-30
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3 301 1.0E-29
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3 301 1.0E-29
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 8 283 1.0E-29
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 5 303 2.0E-29
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 47 292 2.0E-29
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 92 283 3.0E-29
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 40 280 3.0E-29
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 11 286 3.0E-29
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 8 296 3.0E-29
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3 303 4.0E-29
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 89 280 4.0E-29
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 89 294 5.0E-29
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 10 302 8.0E-29
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 283 2.0E-28
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 8 303 2.0E-28
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 5 292 3.0E-28
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3 228 3.0E-28
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2 292 7.0E-28
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 89 297 8.0E-28
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 9 283 3.0E-27
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 8 283 5.0E-27
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 8 283 7.0E-27
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 6 283 9.0E-27
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 6 287 2.0E-26
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 8 297 2.0E-26
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 9 303 2.0E-26
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 9 303 2.0E-26
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 8 279 3.0E-26
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 8 283 1.0E-25
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 37 288 1.0E-25
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 37 288 1.0E-25
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 8 295 4.0E-25
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 5 289 7.0E-25
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 7 286 1.0E-24
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 10 289 2.0E-24
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 8 289 4.0E-24
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 8 289 4.0E-24
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 8 289 4.0E-24
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 11 297 4.0E-24
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 8 279 9.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 5 318 8.0E-23
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 8 279 3.0E-22
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 41 289 3.0E-22
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 10 286 4.0E-22
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 10 285 5.0E-22
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 6 300 6.0E-22
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 12 280 1.0E-21
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 8 286 1.0E-21
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 8 299 2.0E-21
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 63 308 3.0E-21
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 10 285 4.0E-21
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 10 285 4.0E-21
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 9 280 1.0E-20
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 5 294 1.0E-20
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 3 224 4.0E-20
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 10 289 8.0E-20
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 3 224 8.0E-20
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 3 224 8.0E-20
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 8 279 1.0E-19
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 8 279 1.0E-19
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 5 238 1.0E-19
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3 291 2.0E-19
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 9 280 2.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 48 218 3.0E-19
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3 289 4.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3 228 7.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 5 294 8.0E-19
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 9 284 8.0E-19
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 4 284 1.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5 280 2.0E-18
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 9 285 5.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5 312 6.0E-18
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 9 285 8.0E-18
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 89 279 2.0E-17
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 89 279 2.0E-17
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 89 279 3.0E-17
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 89 279 3.0E-17
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 89 279 3.0E-17
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 89 279 3.0E-17
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 89 279 3.0E-17
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 89 279 3.0E-17
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 89 279 3.0E-17
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 89 279 3.0E-17
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 89 279 3.0E-17
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 9 285 3.0E-17
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2 284 4.0E-17
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2 284 4.0E-17
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 89 283 5.0E-17
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 9 285 6.0E-17
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 9 285 7.0E-17
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2 284 9.0E-17
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 9 280 2.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5 284 3.0E-16
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 9 280 3.0E-16
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 9 280 4.0E-16
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 9 280 4.0E-16
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 9 280 4.0E-16
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 9 280 4.0E-16
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 9 280 4.0E-16
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 9 280 4.0E-16
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 11 279 4.0E-16
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 45 294 6.0E-16
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 7 335 6.0E-16
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 10 283 6.0E-16
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 10 218 8.0E-16
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 111 244 1.0E-15
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 10 279 1.0E-15
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 9 280 1.0E-15
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 10 279 1.0E-15
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 10 279 1.0E-15
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 9 280 2.0E-15
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 114 291 2.0E-15
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 9 280 2.0E-15
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 5 215 3.0E-15
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 10 279 8.0E-15
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 10 279 8.0E-15
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 5 224 9.0E-15
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3 297 9.0E-15
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 5 285 1.0E-14
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 10 279 6.0E-14
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 10 279 6.0E-14
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 10 279 6.0E-14
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 10 279 6.0E-14
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3 288 1.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 63 289 1.0E-13
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 10 279 1.0E-13
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 114 310 3.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 5 284 4.0E-13
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 89 279 4.0E-13
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 10 289 6.0E-13
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 11 287 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3 289 6.0E-12
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3 235 8.0E-12
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3 231 1.0E-11
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 114 287 2.0E-11
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 53 221 4.0E-11
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 10 292 4.0E-11
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 53 284 4.0E-11
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 114 284 6.0E-11
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 114 284 6.0E-11
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 14 285 1.0E-10
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 59 284 1.0E-10
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 9 281 2.0E-10
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 118 293 2.0E-10
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 118 293 2.0E-10
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 59 284 3.0E-10
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 5 289 4.0E-10
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 3 284 4.0E-10
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5 227 5.0E-10
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 114 284 8.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 14 284 1.0E-09
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 126 284 1.0E-09
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 53 292 2.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 172 283 3.0E-09
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 53 284 5.0E-09
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 53 284 5.0E-09
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 95 294 6.0E-09
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 5 216 8.0E-09
sp|Q9QUJ7|ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=1 SV=2 138 244 8.0E-09
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 114 296 8.0E-09
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 51 284 1.0E-08
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 123 244 1.0E-08
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 59 284 1.0E-08
sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3 138 249 1.0E-08
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 52 284 2.0E-08
sp|Q9CZW4|ACSL3_MOUSE Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculus GN=Acsl3 PE=1 SV=2 138 249 2.0E-08
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 63 359 2.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 59 284 2.0E-08
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 52 284 2.0E-08
sp|O35547|ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus GN=Acsl4 PE=1 SV=1 138 244 2.0E-08
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 63 295 3.0E-08
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 92 285 3.0E-08
sp|Q63151|ACSL3_RAT Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norvegicus GN=Acsl3 PE=1 SV=1 138 249 3.0E-08
sp|Q5R668|ACSL3_PONAB Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2 138 249 3.0E-08
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 41 284 6.0E-08
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 53 284 6.0E-08
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 89 300 9.0E-08
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 170 295 1.0E-07
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 174 228 1.0E-07
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 14 284 1.0E-07
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 89 289 2.0E-07
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 89 289 2.0E-07
sp|Q9CAP8|LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana GN=LACS9 PE=1 SV=1 92 278 3.0E-07
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 112 286 3.0E-07
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 55 284 4.0E-07
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 112 283 4.0E-07
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 40 286 5.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 44 287 5.0E-07
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 40 286 8.0E-07
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 52 284 8.0E-07
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 114 296 1.0E-06
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 9 286 2.0E-06
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 116 289 2.0E-06
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 116 289 2.0E-06
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 116 289 2.0E-06
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 40 290 2.0E-06
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 53 284 3.0E-06
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 53 284 3.0E-06
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 92 284 3.0E-06
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 92 285 3.0E-06
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 60 233 3.0E-06
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 118 291 4.0E-06
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 34 296 5.0E-06
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 9 286 7.0E-06
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 172 288 7.0E-06
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 105 284 8.0E-06
sp|Q973W5|HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_07830 PE=1 SV=1 174 296 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 355 377 22
2 382 401 19
3 435 452 17
4 486 508 22
5 521 543 22
6 558 575 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2906
MSVGQVLNISFDMAAWEIFACLCNGGTLVVRGSQWEPTIRELDVLICTPTILSKYQPVEYPRIKVVATAGEPTSQ
ALADLWAKHATYWNCCGPTETTIVNTMSRHVAGERVSIGRPTPNNAVYILDDARQPVPLGVPGVMWAGGRGISRG
YVALDSKTRESYIPDPFLLDGSHMYCTGDLGQWRPDGSIDILGRCDDQVKVKGFRVELDGVSTSLASAPGVSRAT
ALLVDGSIHGFVVPSGQSVEAVLRHAQTLQPYYALPARLHQLDEFPTTANGKIDKAILRALAASPAPAGDVEKRP
ATARSASDCGTLVETRSISSASTVTAVSDSPADLEKQMPAKRLPQPLRGLRHRLLIVYRLLFSLVGLVNLCALAA
VLTLGPAGLEWLGILTAANLLAAVLVRQDAVINLLYTVFCSLPRSAPLWMRSRCAKIYHLGGVHSGAGVGATAWL
VASTVQSTASYVRAARAGPEPDEPEEAAGAPSAATVAVSWLLCVLCAAMIGSAWPSFRKRHHNLFERLHRFLGWT
ALALFWVRTVLSVSDAVPAGADVGPALARSPPFWMLAVATVGVASSWFWLRRVRVDAVPLSDHAVQLNFDYTVPV
NGTFTRLATRPLLEWHSFATIPVPRPSPASAARPGYSLVVSNAGDWTRDCVRNPPTRIWVRGLPTCGVMRIATLF
NRIVVVATGSGIGPLLGHISAPSCPTQLIWSTPSPEQTFGKGIIATIRRSIPDAIIHDTRIKGRPDLVKMGYNLA
RDFGAEAVVIIANEKITKKVVYGLETRGIPAYGAIWDS*
Coding >Hirsu2|2906
ATGTCCGTCGGCCAGGTTCTCAATATAAGCTTCGACATGGCCGCGTGGGAGATCTTTGCGTGTTTGTGCAACGGC
GGCACCCTTGTCGTCCGAGGGTCACAATGGGAGCCCACGATCCGGGAGCTCGACGTCCTCATCTGCACCCCTACC
ATCCTGTCCAAGTACCAGCCGGTCGAGTACCCGCGCATCAAGGTGGTGGCCACGGCCGGCGAGCCGACGTCCCAG
GCGCTGGCCGACCTCTGGGCCAAGCACGCGACCTACTGGAACTGCTGCGGCCCGACGGAGACGACCATCGTCAAC
ACCATGTCGCGGCACGTCGCCGGCGAGCGCGTCTCCATCGGCCGCCCGACGCCCAACAATGCCGTCTACATCCTC
GACGACGCCCGCCAGCCCGTCCCGCTGGGCGTGCCCGGAGTGATGTGGGCGGGCGGCCGCGGCATCTCTCGTGGC
TACGTCGCGCTCGACTCCAAGACAAGGGAGTCGTACATTCCCGACCCCTTCCTCCTCGACGGATCGCACATGTAC
TGCACCGGTGACCTGGGCCAGTGGAGGCCGGACGGCTCCATCGACATTCTCGGCCGCTGCGATGACCAGGTCAAG
GTCAAGGGGTTCCGTGTCGAGCTCGACGGCGTGTCCACCTCGCTGGCCTCGGCACCGGGCGTGTCCCGAGCGACG
GCCCTGCTGGTGGACGGCTCGATCCACGGCTTCGTCGTGCCGTCGGGCCAGAGCGTCGAGGCCGTGCTGCGGCAC
GCCCAGACGCTGCAGCCCTACTACGCCCTGCCGGCGCGGCTGCACCAGCTCGACGAGTTCCCGACGACGGCCAAC
GGCAAGATCGACAAGGCGATCCTGCGCGCCCTGGCGGCCTCGCCGGCGCCGGCCGGCGACGTCGAGAAGCGGCCG
GCGACGGCCCGGTCGGCCAGCGACTGCGGCACCCTGGTCGAGACGCGGTCCATCTCCTCGGCCTCGACCGTCACC
GCCGTCTCCGACTCGCCGGCGGACCTGGAGAAGCAGATGCCGGCGAAGCGGCTGCCGCAGCCGCTGCGCGGGCTC
CGGCACCGCCTCCTCATCGTCTACCGCCTGCTCTTCAGCCTCGTCGGCCTGGTCAACCTCTGCGCCCTGGCGGCG
GTGCTGACGCTCGGCCCGGCCGGGCTCGAGTGGCTCGGCATCCTGACGGCCGCGAACCTGCTGGCGGCCGTGCTG
GTGCGCCAGGACGCCGTCATCAACCTGCTCTACACCGTCTTCTGCTCGCTGCCGCGCTCGGCGCCGCTGTGGATG
CGCAGCCGGTGCGCCAAGATCTACCACCTCGGCGGCGTCCACTCCGGCGCCGGCGTCGGCGCCACCGCCTGGCTG
GTCGCGTCGACGGTCCAGTCGACGGCCTCGTACGTCCGGGCCGCGCGGGCCGGGCCCGAGCCGGACGAGCCGGAA
GAGGCGGCCGGCGCCCCCTCGGCCGCGACCGTGGCCGTGTCCTGGCTGCTGTGCGTCCTGTGCGCGGCCATGATC
GGCTCCGCCTGGCCGTCCTTCCGCAAGCGCCACCACAACCTGTTCGAGCGCCTGCACCGCTTCCTCGGCTGGACG
GCGCTGGCCCTGTTCTGGGTCCGGACCGTGCTCTCCGTCTCGGACGCGGTGCCGGCCGGCGCCGACGTCGGCCCC
GCCCTGGCCCGGAGCCCGCCCTTCTGGATGCTGGCCGTCGCGACCGTCGGCGTGGCCTCGTCCTGGTTCTGGCTG
CGGCGCGTCCGCGTCGACGCCGTCCCGCTCTCGGACCACGCCGTCCAGCTCAACTTCGACTACACGGTGCCGGTC
AACGGCACCTTCACCCGGCTCGCGACCCGGCCGCTGCTGGAGTGGCACTCGTTCGCGACGATCCCGGTGCCGCGC
CCGTCGCCGGCGTCCGCCGCCCGGCCCGGCTACTCGCTCGTCGTCTCCAACGCCGGCGACTGGACGCGCGACTGC
GTGCGCAACCCGCCCACGCGCATCTGGGTGCGCGGCCTGCCCACCTGCGGCGTCATGCGCATCGCCACCCTCTTC
AACCGCATCGTCGTCGTCGCCACCGGCTCCGGCATCGGGCCGCTGCTGGGCCACATCTCCGCGCCCAGCTGCCCG
ACGCAGCTGATCTGGTCGACGCCGTCGCCGGAGCAGACGTTCGGCAAGGGCATCATCGCCACCATCCGCCGCTCC
ATCCCAGACGCCATCATCCACGACACGAGGATAAAGGGCCGGCCCGACCTCGTCAAGATGGGCTACAACCTGGCC
CGGGACTTTGGCGCCGAGGCCGTCGTCATCATCGCCAACGAGAAAATCACCAAGAAAGTCGTCTATGGCCTCGAA
ACAAGAGGCATTCCTGCATACGGAGCTATTTGGGATAGCTAA
Transcript >Hirsu2|2906
ATGTCCGTCGGCCAGGTTCTCAATATAAGCTTCGACATGGCCGCGTGGGAGATCTTTGCGTGTTTGTGCAACGGC
GGCACCCTTGTCGTCCGAGGGTCACAATGGGAGCCCACGATCCGGGAGCTCGACGTCCTCATCTGCACCCCTACC
ATCCTGTCCAAGTACCAGCCGGTCGAGTACCCGCGCATCAAGGTGGTGGCCACGGCCGGCGAGCCGACGTCCCAG
GCGCTGGCCGACCTCTGGGCCAAGCACGCGACCTACTGGAACTGCTGCGGCCCGACGGAGACGACCATCGTCAAC
ACCATGTCGCGGCACGTCGCCGGCGAGCGCGTCTCCATCGGCCGCCCGACGCCCAACAATGCCGTCTACATCCTC
GACGACGCCCGCCAGCCCGTCCCGCTGGGCGTGCCCGGAGTGATGTGGGCGGGCGGCCGCGGCATCTCTCGTGGC
TACGTCGCGCTCGACTCCAAGACAAGGGAGTCGTACATTCCCGACCCCTTCCTCCTCGACGGATCGCACATGTAC
TGCACCGGTGACCTGGGCCAGTGGAGGCCGGACGGCTCCATCGACATTCTCGGCCGCTGCGATGACCAGGTCAAG
GTCAAGGGGTTCCGTGTCGAGCTCGACGGCGTGTCCACCTCGCTGGCCTCGGCACCGGGCGTGTCCCGAGCGACG
GCCCTGCTGGTGGACGGCTCGATCCACGGCTTCGTCGTGCCGTCGGGCCAGAGCGTCGAGGCCGTGCTGCGGCAC
GCCCAGACGCTGCAGCCCTACTACGCCCTGCCGGCGCGGCTGCACCAGCTCGACGAGTTCCCGACGACGGCCAAC
GGCAAGATCGACAAGGCGATCCTGCGCGCCCTGGCGGCCTCGCCGGCGCCGGCCGGCGACGTCGAGAAGCGGCCG
GCGACGGCCCGGTCGGCCAGCGACTGCGGCACCCTGGTCGAGACGCGGTCCATCTCCTCGGCCTCGACCGTCACC
GCCGTCTCCGACTCGCCGGCGGACCTGGAGAAGCAGATGCCGGCGAAGCGGCTGCCGCAGCCGCTGCGCGGGCTC
CGGCACCGCCTCCTCATCGTCTACCGCCTGCTCTTCAGCCTCGTCGGCCTGGTCAACCTCTGCGCCCTGGCGGCG
GTGCTGACGCTCGGCCCGGCCGGGCTCGAGTGGCTCGGCATCCTGACGGCCGCGAACCTGCTGGCGGCCGTGCTG
GTGCGCCAGGACGCCGTCATCAACCTGCTCTACACCGTCTTCTGCTCGCTGCCGCGCTCGGCGCCGCTGTGGATG
CGCAGCCGGTGCGCCAAGATCTACCACCTCGGCGGCGTCCACTCCGGCGCCGGCGTCGGCGCCACCGCCTGGCTG
GTCGCGTCGACGGTCCAGTCGACGGCCTCGTACGTCCGGGCCGCGCGGGCCGGGCCCGAGCCGGACGAGCCGGAA
GAGGCGGCCGGCGCCCCCTCGGCCGCGACCGTGGCCGTGTCCTGGCTGCTGTGCGTCCTGTGCGCGGCCATGATC
GGCTCCGCCTGGCCGTCCTTCCGCAAGCGCCACCACAACCTGTTCGAGCGCCTGCACCGCTTCCTCGGCTGGACG
GCGCTGGCCCTGTTCTGGGTCCGGACCGTGCTCTCCGTCTCGGACGCGGTGCCGGCCGGCGCCGACGTCGGCCCC
GCCCTGGCCCGGAGCCCGCCCTTCTGGATGCTGGCCGTCGCGACCGTCGGCGTGGCCTCGTCCTGGTTCTGGCTG
CGGCGCGTCCGCGTCGACGCCGTCCCGCTCTCGGACCACGCCGTCCAGCTCAACTTCGACTACACGGTGCCGGTC
AACGGCACCTTCACCCGGCTCGCGACCCGGCCGCTGCTGGAGTGGCACTCGTTCGCGACGATCCCGGTGCCGCGC
CCGTCGCCGGCGTCCGCCGCCCGGCCCGGCTACTCGCTCGTCGTCTCCAACGCCGGCGACTGGACGCGCGACTGC
GTGCGCAACCCGCCCACGCGCATCTGGGTGCGCGGCCTGCCCACCTGCGGCGTCATGCGCATCGCCACCCTCTTC
AACCGCATCGTCGTCGTCGCCACCGGCTCCGGCATCGGGCCGCTGCTGGGCCACATCTCCGCGCCCAGCTGCCCG
ACGCAGCTGATCTGGTCGACGCCGTCGCCGGAGCAGACGTTCGGCAAGGGCATCATCGCCACCATCCGCCGCTCC
ATCCCAGACGCCATCATCCACGACACGAGGATAAAGGGCCGGCCCGACCTCGTCAAGATGGGCTACAACCTGGCC
CGGGACTTTGGCGCCGAGGCCGTCGTCATCATCGCCAACGAGAAAATCACCAAGAAAGTCGTCTATGGCCTCGAA
ACAAGAGGCATTCCTGCATACGGAGCTATTTGGGATAGCTAA
Gene >Hirsu2|2906
ATGTCCGTCGGCCAGGTTCTCAATATAAGCTTCGACATGGGTGAGCTCCCCCGTCACCACGCCCCCCCCCCTTCT
CCAGCTTCATCCTCAAGGGTCCCCCCGGCCGATCATGTTCCACGATCTCCCGCTCTTCCGTCCATCGTCGACTGA
CCTCATCTGCCGCCAGCCGCGTGGGAGATCTTTGCGTGTTTGTGCAACGGCGGCACCCTTGTCGTCCGAGGGTCA
CAATGGGAGCCCACGATCCGGGAGGTGAGTTGCGAGCCTCCTATCCCGAGAGAGAGAGATACGAGGGGAAGCGGC
TGGAGAGGGGGAGCCGTGACAGCCACGAGGCAGCCCGCTGACTCGGACGATGCTCGGCGGCCTCACAGCTCGACG
TCCTCATCTGCACCCCTACCATCCTGTCCAAGTACCAGCCGGTCGAGTACCCGCGCATCAAGGTGGTGGCCACGG
CCGGCGAGCCGACGTCCCAGGCGCTGGCCGACCTCTGGGCCAAGCACGCGACCTACTGGAACTGCTGCGGCCCGA
CGGAGACGACCATCGTCAACACCATGTCGCGGCACGTCGCCGGCGAGCGCGTCTCCATCGGCCGCCCGACGCCCA
ACAATGCCGTCTACATCCTCGACGACGCCCGCCAGCCCGTCCCGCTGGGCGTGCCCGGAGTGATGTGGGCGGGCG
GCCGCGGCATCTCTCGTGGCTACGTCGCGCTCGACTCCAAGACAAGGGAGTCGTACATTCCCGACCCCTTCCTCC
TCGACGGGTAAGACCTCGGGCCCTTGCCTCAACCGGCATCAGCTCCGGAGCTGTGGACGAGAGATCAGAGAGAGA
GAGAGAGAAAGAGGGCTGACACGGGCATGCGTGTCTCATTAGATCGCACATGTACTGCACCGGTGACCTGGGCCA
GTGGAGGCCGGACGGCTCCATCGACATTCTCGGCCGCTGCGATGACCAGGTCAAGGTCAAGGTGAGTCGGATCCC
TTCTCTGTCACTCTCTCTCTCTCCCACTCCTGTCTCTCCCTCCCTCCGTCCGTCCCAGACGGTCCAAGACGCGGC
CTCGGTCTGACCAGGAAACCAAAACTCAGGGGTTCCGTGTCGAGCTCGACGGCGTGTCCACCTCGCTGGCCTCGG
CACCGGGCGTGTCCCGAGCGACGGCCCTGCTGGTGGACGGCTCGATCCACGGCTTCGTCGTGCCGTCGGGCCAGA
GCGTCGAGGCCGTGCTGCGGCACGCCCAGACGCTGCAGCCCTACTACGCCCTGCCGGCGCGGCTGCACCAGCTCG
ACGAGTTCCCGACGACGGCCAACGGCAAGATCGACAAGGCGATCCTGCGCGCCCTGGCGGCCTCGCCGGCGCCGG
CCGGCGACGTCGAGAAGCGGCCGGCGACGGCCCGGTCGGCCAGCGACTGCGGCACCCTGGTCGAGACGCGGTCCA
TCTCCTCGGCCTCGACCGTCACCGCCGTCTCCGACTCGCCGGCGGACCTGGAGAAGCAGATGCCGGCGAAGCGGC
TGCCGCAGCCGCTGCGCGGGCTCCGGCACCGCCTCCTCATCGTCTACCGCCTGCTCTTCAGCCTCGTCGGCCTGG
TCAACCTCTGCGCCCTGGCGGCGGTGCTGACGCTCGGCCCGGCCGGGCTCGAGTGGCTCGGCATCCTGACGGCCG
CGAACCTGCTGGCGGCCGTGCTGGTGCGCCAGGACGCCGTCATCAACCTGCTCTACACCGTCTTCTGCTCGCTGC
CGCGCTCGGCGCCGCTGTGGATGCGCAGCCGGTGCGCCAAGATCTACCACCTCGGCGGCGTCCACTCCGGCGCCG
GCGTCGGCGCCACCGCCTGGCTGGTCGCGTCGACGGTCCAGTCGACGGCCTCGTACGTCCGGGCCGCGCGGGCCG
GGCCCGAGCCGGACGAGCCGGAAGAGGCGGCCGGCGCCCCCTCGGCCGCGACCGTGGCCGTGTCCTGGCTGCTGT
GCGTCCTGTGCGCGGCCATGATCGGCTCCGCCTGGCCGTCCTTCCGCAAGCGCCACCACAACCTGTTCGAGCGCC
TGCACCGCTTCCTCGGCTGGACGGCGCTGGCCCTGTTCTGGGTCCGGACCGTGCTCTCCGTCTCGGACGCGGTGC
CGGCCGGCGCCGACGTCGGCCCCGCCCTGGCCCGGAGCCCGCCCTTCTGGATGCTGGCCGTCGCGACCGTCGGCG
TGGCCTCGTCCTGGTTCTGGCTGCGGCGCGTCCGCGTCGACGCCGTCCCGCTCTCGGACCACGCCGTCCAGCTCA
ACTTCGACTACACGGTGCCGGTCAACGGCACCTTCACCCGGCTCGCGACCCGGCCGCTGCTGGAGTGGCACTCGT
TCGCGACGATCCCGGTGCCGCGCCCGTCGCCGGCGTCCGCCGCCCGGCCCGGCTACTCGCTCGTCGTCTCCAACG
CCGGCGACTGGACGCGCGACTGCGTGCGCAACCCGCCCACGCGCATCTGGGTGCGCGGCCTGCCCACCTGCGGCG
TCATGCGCATCGCCACCCTCTTCAACCGCATCGTCGTCGTCGCCACCGGCTCCGGCATCGGGCCGCTGCTGGGCC
ACATCTCCGCGCCCAGCTGCCCGACGCAGCTGATCTGGTCGACGCCGTCGCCGGAGCAGACGTTCGGCAAGGGCA
TCATCGCCACCATCCGCCGCTCCATCCCAGACGCCATCATCCACGACACGAGGATAAAGGGCCGGCCCGACCTCG
TCAAGATGGGCTACAACCTGGCCCGGGACTTTGGCGCCGAGGCCGTCGTCATCATCGCCAACGAGAAAATCACCA
AGAAAGTCGTCTATGGCCTCGAAACAAGAGGCATTCCTGCATACGGAGCTATTTGGGATAGCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail