Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2902
Gene name
LocationContig_172:26590..27540
Strand-
Gene length (bp)950
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.5E-25 13 232

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13729|PUN1_SCHPO SUR7 family protein pun1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pun1 PE=3 SV=1 32 225 1.0E-12

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0044464 cell part No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 142 164 22
3 174 196 22
4 217 239 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2902
MAVPIARRNTTIAAAVCYFLTIPFLLLVLVGNTRQDNAVLTDIYFFKLDVSQIIPIAVSNSNLLNSVARSLGLHD
FYQVGLWNFCEGYNNEGVTFCSVPSQFYWFNPVEILVGELLAGAKIALPSAVITILRLLRIGSQTMYVCFMAGTV
VNFVLLFATPLVLRTRWFTLLVGTIAFASGLVLTVAAIIATVISLAAKIALTAQDQLNISAHIGTKMFAFMWLGA
LLTDLAFLLHAAMGCCCRPYRAVRAPDSPRPPTEEKKAIPLPEFVRRRRPAAA*
Coding >Hirsu2|2902
ATGGCCGTCCCCATCGCGCGCCGTAACACGACCATCGCCGCCGCCGTCTGCTACTTTCTCACCATCCCGTTCCTC
CTGCTCGTCCTCGTCGGCAACACGCGCCAGGACAACGCCGTCCTGACCGACATCTACTTCTTCAAGCTCGACGTC
TCCCAGATCATCCCCATCGCCGTCTCCAACTCCAACCTGCTCAACTCGGTCGCCCGCAGCCTCGGCCTCCACGAC
TTCTACCAGGTCGGCCTGTGGAACTTTTGCGAGGGCTACAACAATGAAGGCGTCACCTTTTGTTCGGTGCCGAGC
CAGTTCTACTGGTTCAACCCGGTCGAGATCCTCGTCGGCGAGCTGCTTGCGGGCGCCAAGATCGCCCTACCGTCG
GCCGTCATCACCATCCTGCGGCTCCTGAGGATCGGCTCCCAGACCATGTACGTCTGCTTCATGGCCGGCACCGTC
GTCAACTTCGTCCTCTTGTTCGCCACGCCGCTCGTCCTGCGCACCCGCTGGTTCACCCTGCTGGTCGGCACCATC
GCCTTCGCCTCGGGGCTCGTCCTGACCGTGGCCGCCATCATCGCCACCGTCATCAGCCTGGCGGCCAAGATCGCC
CTGACGGCCCAGGACCAGCTCAACATCAGCGCCCACATCGGCACCAAGATGTTCGCCTTCATGTGGCTCGGCGCC
CTGCTGACCGACCTGGCCTTCCTGCTGCACGCCGCCATGGGCTGCTGCTGCCGGCCCTACCGCGCCGTCCGCGCC
CCGGACTCGCCCAGGCCGCCGACGGAGGAGAAGAAGGCCATCCCGCTTCCCGAGTTTGTCCGGCGAAGGCGGCCC
GCCGCGGCCTAG
Transcript >Hirsu2|2902
ATGGCCGTCCCCATCGCGCGCCGTAACACGACCATCGCCGCCGCCGTCTGCTACTTTCTCACCATCCCGTTCCTC
CTGCTCGTCCTCGTCGGCAACACGCGCCAGGACAACGCCGTCCTGACCGACATCTACTTCTTCAAGCTCGACGTC
TCCCAGATCATCCCCATCGCCGTCTCCAACTCCAACCTGCTCAACTCGGTCGCCCGCAGCCTCGGCCTCCACGAC
TTCTACCAGGTCGGCCTGTGGAACTTTTGCGAGGGCTACAACAATGAAGGCGTCACCTTTTGTTCGGTGCCGAGC
CAGTTCTACTGGTTCAACCCGGTCGAGATCCTCGTCGGCGAGCTGCTTGCGGGCGCCAAGATCGCCCTACCGTCG
GCCGTCATCACCATCCTGCGGCTCCTGAGGATCGGCTCCCAGACCATGTACGTCTGCTTCATGGCCGGCACCGTC
GTCAACTTCGTCCTCTTGTTCGCCACGCCGCTCGTCCTGCGCACCCGCTGGTTCACCCTGCTGGTCGGCACCATC
GCCTTCGCCTCGGGGCTCGTCCTGACCGTGGCCGCCATCATCGCCACCGTCATCAGCCTGGCGGCCAAGATCGCC
CTGACGGCCCAGGACCAGCTCAACATCAGCGCCCACATCGGCACCAAGATGTTCGCCTTCATGTGGCTCGGCGCC
CTGCTGACCGACCTGGCCTTCCTGCTGCACGCCGCCATGGGCTGCTGCTGCCGGCCCTACCGCGCCGTCCGCGCC
CCGGACTCGCCCAGGCCGCCGACGGAGGAGAAGAAGGCCATCCCGCTTCCCGAGTTTGTCCGGCGAAGGCGGCCC
GCCGCGGCCTAG
Gene >Hirsu2|2902
ATGGCCGTCCCCATCGCGCGCCGTAACACGACCATCGCCGCCGCCGTCTGCTACTTTCTCACCATCCCGTTCCTC
CTGCTCGTCCTCGTCGGCAACACGCGCCAGGACAACGCCGTCCTGACCGACATCTACTTCTTCAAGCTCGACGTC
TCCCAGATCATCCCCATCGCCGTCTCCAACTCCAACCTGCTCAACTCGGTCGCCCGCAGCCTCGGCCTCCACGAC
TTCTACCAGGTCGGCCTGTGGAACTTTTGCGAGGGCTACAACAATGAGTGAGCGCCCGCCCATCCTTCCCTCCTT
TCAATGCGCTCGTCTATTTTCCCCCCTCCTACCTGTGCTGAGTGCTGACCGCGCCTTCGCCCTCGTCGTCGTGTC
TCGCGTAAAGAGGCGTCACCTTTTGTTCGGTGCCGAGCCAGTTCTACTGGTTCAACCCGGTCGAGATCCTCGTCG
GCGAGCTGCTTGCGGGCGCCAAGATCGCCCTACCGTCGGCCGTCATCACCATCCTGCGGCTCCTGAGGATCGGCT
CCCAGACCATGTACGTCTGCTTCATGGCCGGCACCGTCGTCAACTTCGTCCTCTTGTTCGCCACGCCGCTCGTCC
TGCGCACCCGCTGGTTCACCCTGCTGGTCGGCACCATCGCCTTCGCCTCGGGGCTCGTCCTGACCGTGGCCGCCA
TCATCGCCACCGTCATCAGCCTGGCGGCCAAGATCGCCCTGACGGCCCAGGACCAGCTCAACATCAGCGCCCACA
TCGGCACCAAGATGTTCGCCTTCATGTGGCTCGGCGCCCTGCTGACCGACCTGGCCTTCCTGCTGCACGCCGCCA
TGGGCTGCTGCTGCCGGCCCTACCGCGCCGTCCGCGCCCCGGACTCGCCCAGGCCGCCGACGGAGGAGAAGAAGG
CCATCCCGCTTCCCGAGTTTGTCCGGCGAAGGCGGCCCGCCGCGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail