Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2896
Gene name
LocationContig_172:18..9639
Strand+
Gene length (bp)9621
Transcript length (bp)9621
Coding sequence length (bp)9621
Protein length (aa) 3207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12774 AAA_6 Hydrolytic ATP binding site of dynein motor region 6.2E-103 1045 1284
PF12774 AAA_6 Hydrolytic ATP binding site of dynein motor region 1.6E-17 1302 1395
PF08393 DHC_N2 Dynein heavy chain, N-terminal region 2 3.4E-118 500 902
PF12781 AAA_9 ATP-binding dynein motor region 3.1E-74 2724 2942
PF12780 AAA_8 P-loop containing dynein motor region D4 3.2E-64 2069 2347
PF12775 AAA_7 P-loop containing dynein motor region 1.3E-35 1723 1897
PF12777 MT Microtubule-binding stalk of dynein motor 2.0E-39 2362 2693
PF07728 AAA_5 AAA domain (dynein-related subfamily) 4.1E-12 1383 1517
PF17852 Dynein_AAA_lid Dynein heavy chain AAA lid domain 2.7E-13 1587 1711

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TD57|DYH3_HUMAN Dynein heavy chain 3, axonemal OS=Homo sapiens GN=DNAH3 PE=2 SV=1 547 3053 0.0E+00
sp|Q96DT5|DYH11_HUMAN Dynein heavy chain 11, axonemal OS=Homo sapiens GN=DNAH11 PE=1 SV=4 394 3100 0.0E+00
sp|Q8TE73|DYH5_HUMAN Dynein heavy chain 5, axonemal OS=Homo sapiens GN=DNAH5 PE=1 SV=3 452 3011 0.0E+00
sp|Q9UFH2|DYH17_HUMAN Dynein heavy chain 17, axonemal OS=Homo sapiens GN=DNAH17 PE=1 SV=2 485 3056 0.0E+00
sp|Q8VHE6|DYH5_MOUSE Dynein heavy chain 5, axonemal OS=Mus musculus GN=Dnah5 PE=1 SV=2 452 3043 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TD57|DYH3_HUMAN Dynein heavy chain 3, axonemal OS=Homo sapiens GN=DNAH3 PE=2 SV=1 547 3053 0.0E+00
sp|Q96DT5|DYH11_HUMAN Dynein heavy chain 11, axonemal OS=Homo sapiens GN=DNAH11 PE=1 SV=4 394 3100 0.0E+00
sp|Q8TE73|DYH5_HUMAN Dynein heavy chain 5, axonemal OS=Homo sapiens GN=DNAH5 PE=1 SV=3 452 3011 0.0E+00
sp|Q9UFH2|DYH17_HUMAN Dynein heavy chain 17, axonemal OS=Homo sapiens GN=DNAH17 PE=1 SV=2 485 3056 0.0E+00
sp|Q8VHE6|DYH5_MOUSE Dynein heavy chain 5, axonemal OS=Mus musculus GN=Dnah5 PE=1 SV=2 452 3043 0.0E+00
sp|Q9NYC9|DYH9_HUMAN Dynein heavy chain 9, axonemal OS=Homo sapiens GN=DNAH9 PE=1 SV=3 143 3054 0.0E+00
sp|Q96JB1|DYH8_HUMAN Dynein heavy chain 8, axonemal OS=Homo sapiens GN=DNAH8 PE=1 SV=2 398 3053 0.0E+00
sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA4 PE=3 SV=1 397 3053 0.0E+00
sp|Q91XQ0|DYH8_MOUSE Dynein heavy chain 8, axonemal OS=Mus musculus GN=Dnah8 PE=1 SV=2 425 3053 0.0E+00
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 499 3003 0.0E+00
sp|Q8WXX0|DYH7_HUMAN Dynein heavy chain 7, axonemal OS=Homo sapiens GN=DNAH7 PE=1 SV=2 482 3053 0.0E+00
sp|Q63170|DYH7_RAT Dynein heavy chain 7, axonemal OS=Rattus norvegicus GN=Dnah7 PE=2 SV=2 482 3053 0.0E+00
sp|Q39575|DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA2 PE=1 SV=1 218 3053 0.0E+00
sp|P45443|DYHC_NEUCR Dynein heavy chain, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-1 PE=3 SV=1 1 3104 0.0E+00
sp|Q8BW94|DYH3_MOUSE Dynein heavy chain 3, axonemal OS=Mus musculus GN=Dnah3 PE=1 SV=2 547 3053 0.0E+00
sp|Q9P2D7|DYH1_HUMAN Dynein heavy chain 1, axonemal OS=Homo sapiens GN=DNAH1 PE=2 SV=4 490 2637 0.0E+00
sp|Q6ZR08|DYH12_HUMAN Dynein heavy chain 12, axonemal OS=Homo sapiens GN=DNAH12 PE=2 SV=2 589 2141 0.0E+00
sp|Q923J6|DYH12_RAT Dynein heavy chain 12, axonemal OS=Rattus norvegicus GN=Dnah12 PE=2 SV=2 589 2138 0.0E+00
sp|Q3V0Q1|DYH12_MOUSE Dynein heavy chain 12, axonemal OS=Mus musculus GN=Dnah12 PE=1 SV=2 589 2141 0.0E+00
sp|Q9JJ79|DYHC2_RAT Cytoplasmic dynein 2 heavy chain 1 OS=Rattus norvegicus GN=Dync2h1 PE=1 SV=1 143 1543 0.0E+00
sp|Q45VK7|DYHC2_MOUSE Cytoplasmic dynein 2 heavy chain 1 OS=Mus musculus GN=Dync2h1 PE=1 SV=1 143 1543 0.0E+00
sp|Q9SMH5|DYHC2_CHLRE Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii GN=DHC1B PE=1 SV=2 397 1544 0.0E+00
sp|Q9SMH5|DYHC2_CHLRE Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii GN=DHC1B PE=1 SV=2 1741 3054 0.0E+00
sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens GN=DYNC2H1 PE=1 SV=4 397 1543 0.0E+00
sp|Q19542|DYHC2_CAEEL Cytoplasmic dynein 2 heavy chain 1 OS=Caenorhabditis elegans GN=che-3 PE=3 SV=2 396 1543 0.0E+00
sp|P36022|DYHC_YEAST Dynein heavy chain, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DYN1 PE=1 SV=1 208 3052 0.0E+00
sp|P78716|DYHC_FUSSO Dynein heavy chain, cytoplasmic OS=Fusarium solani subsp. pisi GN=DHC1 PE=3 SV=1 1 3108 0.0E+00
sp|P45444|DYHC_EMENI Dynein heavy chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudA PE=3 SV=2 1 3081 0.0E+00
sp|Q9JHU4|DYHC1_MOUSE Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus GN=Dync1h1 PE=1 SV=2 1 3054 0.0E+00
sp|Q14204|DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens GN=DYNC1H1 PE=1 SV=5 1 3054 0.0E+00
sp|P38650|DYHC1_RAT Cytoplasmic dynein 1 heavy chain 1 OS=Rattus norvegicus GN=Dync1h1 PE=1 SV=1 1 3054 0.0E+00
sp|Q69Z23|DYH17_MOUSE Dynein heavy chain 17, axonemal OS=Mus musculus GN=Dnah17 PE=1 SV=2 483 3056 0.0E+00
sp|P37276|DYHC_DROME Dynein heavy chain, cytoplasmic OS=Drosophila melanogaster GN=Dhc64C PE=2 SV=2 1 3054 0.0E+00
sp|P34036|DYHC_DICDI Dynein heavy chain, cytoplasmic OS=Dictyostelium discoideum GN=dhcA PE=1 SV=2 1 3053 0.0E+00
sp|Q19020|DYHC_CAEEL Dynein heavy chain, cytoplasmic OS=Caenorhabditis elegans GN=dhc-1 PE=1 SV=1 2 3052 0.0E+00
sp|Q27171|DYHC_PARTE Dynein heavy chain, cytoplasmic OS=Paramecium tetraurelia GN=DHC-8 PE=2 SV=1 15 3055 0.0E+00
sp|Q9C1M7|DYHC_ASHGO Dynein heavy chain, cytoplasmic OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DYN1 PE=3 SV=1 152 3041 0.0E+00
sp|O13290|DYHC_SCHPO Dynein heavy chain, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dhc1 PE=1 SV=1 1 3046 0.0E+00
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein MAL7P1.162 OS=Plasmodium falciparum (isolate 3D7) GN=MAL7P1.162 PE=2 SV=2 1556 3078 0.0E+00
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein MAL7P1.162 OS=Plasmodium falciparum (isolate 3D7) GN=MAL7P1.162 PE=2 SV=2 12 1546 0.0E+00
sp|Q9SMH3|DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii GN=DHC1 PE=1 SV=1 225 3069 0.0E+00
sp|Q27802|DYHC2_TRIGR Cytoplasmic dynein 2 heavy chain 1 OS=Tripneustes gratilla GN=DYH1B PE=2 SV=2 399 3055 0.0E+00
sp|Q8IVF4|DYH10_HUMAN Dynein heavy chain 10, axonemal OS=Homo sapiens GN=DNAH10 PE=1 SV=4 206 3002 0.0E+00
sp|Q9MBF8|DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii GN=DHC10 PE=1 SV=1 233 3050 0.0E+00
sp|P0C6F1|DYH2_MOUSE Dynein heavy chain 2, axonemal OS=Mus musculus GN=Dnah2 PE=1 SV=1 236 3003 0.0E+00
sp|Q9C0G6|DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=2 SV=3 436 3053 0.0E+00
sp|Q9P225|DYH2_HUMAN Dynein heavy chain 2, axonemal OS=Homo sapiens GN=DNAH2 PE=2 SV=3 236 3003 0.0E+00
sp|P39057|DYHC_HELCR Dynein beta chain, ciliary OS=Heliocidaris crassispina PE=1 SV=1 396 3053 0.0E+00
sp|P23098|DYHC_TRIGR Dynein beta chain, ciliary OS=Tripneustes gratilla PE=1 SV=1 396 3053 0.0E+00
sp|Q63164|DYH1_RAT Dynein heavy chain 1, axonemal OS=Rattus norvegicus GN=Dnah1 PE=2 SV=2 492 1553 3.0E-160
sp|Q45VK7|DYHC2_MOUSE Cytoplasmic dynein 2 heavy chain 1 OS=Mus musculus GN=Dync2h1 PE=1 SV=1 1649 3002 4.0E-157
sp|Q9JJ79|DYHC2_RAT Cytoplasmic dynein 2 heavy chain 1 OS=Rattus norvegicus GN=Dync2h1 PE=1 SV=1 1649 3002 5.0E-157
sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens GN=DYNC2H1 PE=1 SV=4 1729 3002 6.0E-156
sp|Q63164|DYH1_RAT Dynein heavy chain 1, axonemal OS=Rattus norvegicus GN=Dnah1 PE=2 SV=2 1691 3053 5.0E-147
sp|Q19542|DYHC2_CAEEL Cytoplasmic dynein 2 heavy chain 1 OS=Caenorhabditis elegans GN=che-3 PE=3 SV=2 1730 3060 1.0E-115
sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3 994 1909 3.0E-89
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 1344 2274 2.0E-76
sp|Q9P2D7|DYH1_HUMAN Dynein heavy chain 1, axonemal OS=Homo sapiens GN=DNAH1 PE=2 SV=4 2638 3053 6.0E-56
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 1034 1276 3.0E-52
sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3 2097 2580 4.0E-41
sp|Q96M86|DNHD1_HUMAN Dynein heavy chain domain-containing protein 1 OS=Homo sapiens GN=DNHD1 PE=2 SV=2 511 1763 8.0E-40
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 2729 3006 2.0E-27
sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3 2724 2994 6.0E-26
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 610 854 3.0E-23
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 2325 2691 6.0E-23
sp|Q96M86|DNHD1_HUMAN Dynein heavy chain domain-containing protein 1 OS=Homo sapiens GN=DNHD1 PE=2 SV=2 2074 2694 5.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATPase activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2896
LQSKAVSLIHIHATVEQALAELGTCPYDAPAFQSRLGTVQAAVDQLNLEQYVNLDFWVRGLNHKIQSILLERLHG
AIQAWIAAFEDETPDEGRRRRSTGEGWEGEGEGGGSNNGNSNNNGHNGNSDNNNNNKPSGPTMKRLVLELAMRNQ
VIYLDPPLEYARAGWFLHLHDWLGIVCDLRKIKAARYRMSLATAGAGGGGGGADEPRFTDLATECAAALHRVYVS
VERKLGEVSAYVDKWLQFQSLWDLQSEQVYDMLGDHLPRWLECLQDIRKVRTTFDTQEVSRSFGHITIDYDQVQT
KVNAKYDQWQHEILVKFAGRLGNRMRDVHAEIEKARRHLEGQSSDTSSTAQAVQFITAVQSCRRNVKLWAPEIDM
FRQGQSTLVRQRYHFPADWLHIEQIDSQWEALKEILEKKARVMEEQSDAMRANIAAQDKLVNERIAEVVARWNEE
KPVSGTIQPDVASATLASFESRIAGLQDDFLQVVKAKEALDLPASQDRSLEATLEEVRDFQSVWSSLSTIWAGLN
ETRDVLWTAVQPRKVRAKVDDLIKSTKEMPSRMRQYAAFEHVQGILRGFLKVNPILSDLKSDAIRERHWHKIYKQ
LRPQKRFSPSSMTLGDVWDLNLVATEAVVKDIIAQAQGEMALEEFLKQVRETWQNYALEMVGYQNKCRLIRGWDD
LFAKCSENLNSLQAMKHSPYYKEFEEEAVAWEDKLNRVHVLFDVWIDVQRQWVYLEGVFTGNADIKHLLPIESGR
FQNINSEFLAVMKKANKTPYVLDVLNIPNAQKSLERLAEMLNKIQKALGEYLEKERVSFPRFYFVGDEDLLEMIG
NSNDTLRIAKHFKKMFAGLSGLVMDDESVISGFTSKEGETVKLKRDISLAKTPRINDWLALLEGGMKATLAELLA
EAVARYAPVLEASAVDAAALRRFMDDFPSQIVVLATQVAWTTAVDAALAAGGGGALRALLEREVQVLRVLADTVL
GDLEVILRKKCEQLITECVHQRDAIERLVAAGADSPGHHLWQLQMRYVYTPEGAPLDRLHVRMANARLNYGFEYL
GVPDRLVRTPLTDRCFLTLTQALCQRLGGSPYGPAGTGKTESVKALGVQLGRFTLVFCCDDTFDFQAMGRIFLGI
CQVGAWGCFDEFNRLEERILSAVSQQIQNIQLGLKQGAEDSKSQIELVGRQLAVNENTGIFITMNPGYAGRSNLP
DNLKKLFRSVAMSKPDKELIAEVMLYSQGFNRAKELSKQTVPFFDQCAGQLSRQAHYDFGLRALKSVLVSSGGLK
RARLNNDDDDGDGGGGGGGGGAEQVVVEPEIIVQSIRETIAPKLIKADVDIMTGIEARCFPGVRYVPANLEALEG
AVRALAAERHLVVTDTWMTKVLQLYQIQKIHHGVMMVGNSGSGKSAAWRLLLDALQRVEGVEGVSHVIDSKVMSK
EALYGHLDPTTREWTDGLFTSILRKIVDNLRGEDAKRHWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLNLP
ANVRIMFEVETLRYATLATVSRCGMVWFSEDTVTPSMLVANYLETLGSVPFEDLDEDSVATGQAAARILAVQGQV
ADLLRAYLTSDGFVLEALERARGYGHIMEFTVARVLTTLFSLLNKAVRDVIEYNGRHPDFPLDAEQVEAFVPKKL
LLALVWALTGDCPLADRKAFGDDVCALAGFGSPPPEAAGGAGSLIDYDVSLPRAEWTPWQDQVPTIEVNTHSVTQ
TDVVIPTLDTVRHEDVLYSWLAEHKPLLLCGPPGSGKTMTLFSALRKLPNMEVVGLNFSSATTPDLLIKTFEQYC
EYKKTLNGVTLSPTQIGRWLVVFCDEINLPAPDNYGTQRAISFLRQLVEHNGFWRTSDRSWVALDRIQFVGACNP
PTDAGRTPLGARFLRHAPLVMVDYPGEQSLGQIYGTFNAAVLKVVPSLRGYAEPLTSAMVRLYLESQRRFTPRIQ
PHYVYSPRELTRWVRGVYEAIRPLEALSVEGLVRIWAHEALRLFQDRLVAEEERAWTEEAVRRIALDCFPTVDEE
RALGGPILFSNWLSRNYVPVDREQLRDFVKARLRTFCEEEVDVPLILFNDVLEHVLRIDRVFRQPQGHLILIGVS
GSGKTTLSRFVAWMNGLKVFQIKVHGRYSGDDFDEDLRDVLRRCGCKGEKMCFIMDEANVLDSGFLERMNTLLAN
AEVPGLFEGDDYAALMTACKEGAQRQNLHLDSPEELYRWFTQQIVSNLHVVFTMNPPEGGLSSKAATSPALFNRC
VLNWFGDWSDQALFQVGHELTQSVDLDRAGYRAPDAIPVAYRGLALPPSHREAVVNAMVHIHYSLRRYNERLQRQ
QKRTTFLTPRHFLDFVGQYVRLYNEKREDLEEQQRHLNVGLEKLRDTVDKVRDLRASLAEKKTRLEQKDAEANEK
LQRMVADQREAEQRKNTSLEIQAALERQEAEVATRRRVVLEDLARAEPAVEEAKASVSNIKRQHLTEVRSMGNPP
QGVRLALDAVCTLLGHRINDWKAVQAVVRRDDFIASIIMFDNARQMTRPLRVKMRNDFLSNPEFTFEKVNRASKA
CGPLVQWVAAQVNYSDILDRVGPLKDEVAQLEEQALQTKAEARAVEGNIAALEASIDTYKTEYAALISETQAIKA
EMATVQFKVDRSVRLLDSLSSERTRWEEGSRSFETQIGTLVGDVLVAAAFLAYSGLYDQTFRKSMMDDWCHQLHL
SGIEYKSPNPVTEYLSSADERLGWQENTLPVDDLCTENAIILRRFNRYPLIIDPSGRVTEFLQRECRDRRLTVTS
FLDDTFTKQLESSLRFGNPILIQDAEHLDPILNHVLNKEYQRTGGRVLIQLGRQEIDFSPSFRLYLSTRDPSAQF
APDICSRTTFVNFTVTKSSLQTQSLNDVLKSERPDVDERRTNLIKLQGEFKVHLRQLEKQLLQALNESRGNILDD
DNVIETLETLKTEAADISAKMGRTEGVMAEVEEITRQYGVIANSCSAVFAVLDQLHFLNHFYQFSLQYFLDIFRA
VLDPGRNERLAAAGGDHNARRDIIVRDLFVATFRRTALGLLQKDRITLAMLLAQASPYRMDKSLIDLVLDDRVEG
RDLSTSSSSSSHPDDAAAAAAAAREAIEARRKLWHSSEPATLTLRQSMVLLGAQHGIVTCWPTTLFSWSEMPWPS
LPTTSTHGCCRSGSSRSICSSGTKWSLPYFLSAFRPGGGTAAYVFHPASFDSSRKW*
Coding >Hirsu2|2896
CTGCAGAGCAAGGCCGTCTCCCTCATCCACATCCACGCCACCGTCGAGCAGGCCCTCGCCGAGCTCGGCACCTGC
CCCTACGACGCCCCGGCCTTCCAGTCGCGCCTCGGCACCGTCCAGGCCGCCGTCGACCAGCTGAACCTGGAGCAG
TACGTCAACCTCGACTTCTGGGTCCGCGGCCTGAACCACAAGATCCAGTCCATCCTGCTCGAGCGCCTGCACGGC
GCCATCCAGGCCTGGATCGCCGCCTTCGAGGACGAGACGCCGGACGAGGGCCGGCGGAGGCGGTCGACGGGCGAG
GGCTGGGAGGGCGAGGGCGAGGGGGGCGGGAGCAACAACGGCAACAGCAACAATAACGGCCACAACGGAAACAGC
GACAACAACAACAACAACAAGCCGAGCGGGCCGACGATGAAGCGCCTGGTTCTCGAGCTGGCGATGCGGAACCAG
GTCATCTACCTCGACCCCCCGCTCGAGTACGCGAGGGCCGGCTGGTTCCTCCACCTCCACGACTGGCTCGGCATC
GTCTGCGACCTCCGCAAGATCAAGGCCGCGCGCTACCGGATGAGCCTCGCCACCGCCGGCGCCGGCGGGGGCGGC
GGCGGCGCCGACGAGCCGCGCTTCACGGACCTGGCCACCGAGTGCGCCGCCGCGCTCCACCGCGTCTACGTGTCG
GTGGAGAGGAAGCTCGGCGAGGTCAGCGCCTACGTCGACAAGTGGCTCCAGTTCCAGTCGCTCTGGGACCTCCAG
TCGGAGCAGGTCTACGACATGCTGGGCGACCACCTCCCGCGCTGGCTCGAGTGCCTGCAGGACATCCGCAAGGTG
CGCACCACCTTCGACACGCAGGAGGTCAGCCGCTCCTTCGGCCACATCACCATCGACTACGACCAGGTCCAGACC
AAGGTCAACGCCAAGTACGACCAGTGGCAGCACGAGATCCTCGTCAAGTTCGCCGGCCGGCTGGGCAACCGCATG
CGCGACGTGCACGCCGAGATCGAGAAGGCGCGCCGGCACCTCGAGGGCCAGAGCTCCGACACGTCGTCGACGGCC
CAGGCCGTCCAGTTCATCACGGCCGTCCAGAGCTGCCGGCGCAACGTCAAGCTGTGGGCGCCCGAGATCGACATG
TTCCGCCAGGGGCAGTCGACGCTCGTCCGCCAGCGCTACCACTTCCCGGCCGACTGGCTGCACATCGAGCAGATC
GACAGCCAGTGGGAGGCTCTCAAGGAGATACTGGAGAAGAAGGCGCGCGTCATGGAGGAGCAGTCGGACGCGATG
CGCGCCAACATCGCCGCCCAGGACAAGCTGGTCAACGAGCGCATCGCCGAGGTCGTGGCCCGGTGGAACGAGGAG
AAGCCGGTGTCGGGCACGATCCAGCCCGACGTCGCCTCGGCCACGCTGGCCTCGTTCGAGTCGCGCATCGCCGGC
CTGCAGGACGACTTCCTGCAGGTCGTCAAGGCCAAGGAGGCCCTCGACCTGCCCGCCTCGCAGGACCGGTCGCTG
GAGGCGACGCTCGAGGAGGTGCGCGACTTCCAGTCCGTCTGGTCCAGCCTGTCGACCATCTGGGCCGGCCTCAAC
GAGACGCGCGACGTGCTGTGGACGGCCGTCCAGCCGCGCAAGGTGCGCGCCAAGGTGGACGACCTGATCAAGAGC
ACCAAGGAGATGCCGAGCCGGATGCGGCAGTACGCCGCCTTCGAGCACGTCCAGGGCATCCTCCGCGGCTTCCTC
AAGGTCAACCCCATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGCCACTGGCACAAGATCTACAAGCAG
CTCCGGCCGCAGAAGCGCTTCTCCCCGAGCTCCATGACGCTCGGCGACGTCTGGGACCTGAACCTGGTGGCGACC
GAGGCCGTCGTCAAGGACATCATCGCCCAGGCCCAGGGCGAGATGGCGCTCGAGGAGTTCCTGAAGCAGGTGCGC
GAGACGTGGCAGAACTACGCGCTCGAGATGGTCGGCTACCAGAACAAGTGCCGCCTCATCCGCGGCTGGGACGAC
CTGTTCGCCAAGTGCAGCGAGAACCTCAACTCGCTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAG
GAGGAGGCCGTCGCGTGGGAGGACAAGCTGAACCGCGTCCACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGC
CAGTGGGTCTACCTCGAGGGCGTCTTCACCGGCAACGCCGACATCAAGCACCTGCTGCCCATCGAGTCGGGCCGC
TTCCAGAACATCAACAGCGAGTTCCTGGCCGTCATGAAGAAGGCCAACAAGACGCCCTACGTGCTCGACGTCCTC
AACATACCCAACGCCCAGAAGTCGCTCGAGCGCCTGGCCGAGATGCTCAACAAGATACAGAAGGCGCTGGGCGAG
TACCTCGAGAAGGAGCGCGTCTCGTTCCCGCGCTTCTACTTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGC
AACAGCAACGACACGCTGCGCATCGCCAAGCACTTCAAGAAGATGTTCGCCGGCCTGTCCGGCCTCGTCATGGAC
GACGAGTCCGTCATCTCGGGCTTCACCTCCAAGGAGGGCGAGACGGTCAAGCTGAAGCGGGACATCTCCCTGGCC
AAGACGCCGAGGATCAACGACTGGCTCGCCCTGCTCGAGGGCGGCATGAAGGCGACGCTGGCCGAGCTGCTGGCC
GAGGCCGTCGCCCGCTACGCGCCCGTCCTCGAGGCGAGCGCCGTCGACGCCGCCGCGCTGAGGCGCTTCATGGAC
GACTTCCCCAGCCAGATCGTCGTCCTGGCCACCCAGGTGGCCTGGACGACGGCCGTCGACGCGGCCCTGGCCGCC
GGCGGCGGCGGCGCGCTGCGGGCCCTGCTCGAGCGCGAGGTCCAGGTGCTGCGCGTCCTCGCCGACACGGTGCTC
GGCGACCTCGAGGTGATCCTGCGCAAGAAGTGCGAGCAGCTGATCACCGAGTGCGTCCACCAGCGCGACGCCATC
GAGAGGCTCGTCGCCGCCGGCGCCGACTCGCCCGGCCACCACCTGTGGCAGCTCCAGATGCGCTACGTCTACACG
CCCGAGGGCGCCCCCCTCGACCGCCTCCACGTCCGGATGGCCAACGCCCGGCTCAACTACGGCTTCGAGTACCTC
GGCGTCCCGGACCGCCTCGTGCGGACGCCGCTGACGGACCGCTGCTTCCTCACCCTGACCCAGGCCCTCTGCCAG
CGCCTCGGCGGCTCGCCCTACGGCCCGGCCGGCACGGGCAAGACGGAGTCGGTCAAGGCGCTGGGCGTCCAGCTC
GGCCGCTTCACCCTCGTCTTCTGCTGCGACGACACGTTCGACTTCCAGGCCATGGGCCGCATCTTCCTCGGCATC
TGCCAGGTCGGCGCCTGGGGCTGCTTCGACGAGTTTAACCGGCTCGAGGAGAGGATCCTGTCGGCCGTCTCGCAG
CAGATCCAGAACATCCAGCTCGGCCTCAAGCAGGGCGCCGAGGACAGCAAGTCGCAGATCGAGCTGGTCGGCCGC
CAGCTCGCCGTCAACGAGAACACGGGCATCTTCATCACGATGAACCCCGGCTACGCCGGCCGCTCCAACCTGCCC
GACAACCTCAAGAAGCTGTTCCGGAGCGTGGCCATGTCGAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTC
TACTCGCAGGGCTTCAACCGGGCCAAGGAGCTCTCCAAGCAGACCGTCCCCTTCTTCGACCAGTGCGCCGGCCAG
CTGTCCCGGCAGGCGCACTACGACTTTGGCCTGCGCGCCCTCAAGAGCGTCCTCGTCAGCTCGGGGGGGCTGAAG
CGCGCCCGCCTCAACAACGACGACGACGACGGCGACGGCGGCGGCGGCGGCGGCGGCGGCGGGGCCGAGCAGGTC
GTCGTCGAGCCCGAGATCATCGTGCAGAGCATCCGCGAGACCATCGCCCCGAAGCTGATCAAGGCCGACGTCGAC
ATCATGACGGGCATCGAGGCGCGGTGCTTCCCCGGCGTCCGGTACGTGCCGGCCAACCTCGAGGCGCTGGAGGGG
GCGGTGCGCGCGCTCGCGGCGGAGCGGCACCTGGTCGTCACGGACACGTGGATGACCAAGGTGCTCCAGCTGTAC
CAGATCCAGAAGATCCACCACGGCGTCATGATGGTGGGCAACTCGGGCAGCGGCAAGTCGGCCGCCTGGCGGCTG
CTGCTCGACGCCCTCCAGCGGGTCGAGGGCGTCGAGGGCGTCTCGCACGTCATCGACTCCAAGGTCATGTCCAAG
GAGGCCCTCTACGGCCACCTCGACCCGACGACGCGCGAGTGGACCGACGGCCTCTTCACCAGCATCCTCCGCAAG
ATCGTCGACAACCTCCGCGGCGAGGACGCCAAGCGGCACTGGATCGTCTTCGACGGCGACGTCGACCCGGAGTGG
GTCGAGAACCTGAACAGCGTCCTCGACGACAACAAGCTGCTGACGCTGCCCAACGGCGAGCGGCTGAACCTGCCG
GCCAACGTGCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCCACGCTCGCCACCGTCAGCCGGTGCGGCATG
GTCTGGTTCAGCGAGGACACGGTGACGCCGAGCATGCTGGTGGCCAACTACCTCGAGACGCTCGGCAGCGTCCCC
TTCGAGGACCTGGACGAGGACAGCGTCGCGACGGGGCAGGCGGCGGCCCGGATCCTGGCCGTGCAGGGCCAGGTG
GCGGACCTGCTGCGGGCGTACCTGACGTCGGACGGCTTCGTGCTCGAGGCGCTGGAGCGGGCCCGCGGCTACGGC
CACATCATGGAGTTCACCGTCGCCCGCGTCCTCACCACGCTCTTCTCCCTGCTCAACAAGGCGGTCCGGGACGTG
ATCGAGTACAACGGCCGGCACCCGGACTTCCCGCTCGACGCGGAGCAGGTCGAGGCCTTCGTGCCCAAGAAGCTG
CTGCTCGCCCTCGTCTGGGCCCTGACGGGCGACTGCCCGCTGGCGGACCGCAAGGCCTTCGGCGACGACGTCTGC
GCCCTGGCCGGCTTCGGCTCGCCGCCGCCCGAGGCGGCGGGCGGCGCCGGCTCGCTCATCGACTACGACGTGAGC
CTGCCGCGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCGACCATCGAGGTCAACACGCACTCGGTCACGCAG
ACGGACGTGGTGATCCCGACGCTGGACACGGTCCGGCACGAGGACGTGCTCTACTCGTGGCTCGCCGAGCACAAG
CCGCTGCTGCTGTGCGGGCCGCCCGGCTCGGGCAAGACGATGACGCTCTTCAGCGCGCTGCGCAAGCTGCCCAAC
ATGGAGGTGGTCGGCCTCAACTTCTCGAGCGCGACGACGCCCGACCTCCTGATCAAGACGTTCGAGCAGTACTGC
GAGTACAAGAAGACGCTCAACGGGGTGACGCTGTCGCCGACGCAGATCGGCCGCTGGCTCGTCGTCTTCTGCGAC
GAGATCAACCTGCCGGCGCCGGACAACTACGGGACGCAGCGGGCCATCTCCTTCCTGCGCCAGCTGGTCGAGCAC
AACGGCTTCTGGCGCACGTCGGACCGGTCGTGGGTCGCGCTGGACCGCATCCAGTTCGTCGGCGCCTGCAACCCG
CCGACGGACGCCGGGCGCACGCCGCTGGGCGCGCGCTTCCTGCGCCACGCGCCCCTCGTCATGGTCGACTACCCG
GGCGAGCAGTCGCTCGGCCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAGGTGGTGCCGTCGCTGCGCGGC
TACGCCGAGCCGCTGACGAGCGCCATGGTGCGCCTCTACCTCGAGTCGCAGCGGCGCTTCACGCCCCGGATCCAG
CCGCACTACGTCTACAGCCCGCGCGAGCTGACGCGCTGGGTGCGCGGCGTCTACGAGGCCATCCGGCCGCTCGAG
GCGCTCTCGGTCGAGGGCCTGGTCCGCATCTGGGCCCACGAGGCGCTCCGGCTCTTCCAGGACCGGCTCGTGGCC
GAGGAGGAGCGGGCGTGGACGGAGGAGGCGGTCCGGCGCATCGCCCTCGACTGCTTCCCCACCGTCGACGAGGAG
CGGGCGCTGGGCGGGCCCATCCTCTTCTCCAACTGGCTGTCGAGGAACTACGTGCCGGTGGACCGCGAGCAGCTG
CGCGACTTCGTCAAGGCGCGGCTGCGGACCTTTTGCGAGGAGGAGGTGGACGTGCCGCTGATACTGTTCAACGAC
GTGCTCGAGCACGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGCCACCTGATACTGATCGGCGTCAGC
GGCAGCGGCAAGACGACGCTCTCGCGCTTCGTGGCCTGGATGAACGGCCTCAAGGTCTTCCAGATCAAGGTGCAC
GGCCGGTACTCGGGCGACGACTTCGACGAGGACCTGCGCGACGTGCTCCGCCGCTGCGGCTGCAAGGGCGAGAAG
ATGTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCCTCGAGCGCATGAACACGCTGCTCGCCAAC
GCCGAGGTGCCCGGCCTGTTCGAGGGCGACGACTACGCCGCCCTGATGACGGCCTGCAAGGAGGGCGCGCAGCGG
CAGAACCTGCACCTGGACTCGCCCGAGGAGCTGTACCGCTGGTTCACGCAGCAGATCGTCAGCAACCTGCACGTC
GTCTTCACCATGAACCCGCCCGAGGGCGGGCTGTCGTCCAAGGCGGCGACGAGCCCGGCCCTCTTCAACCGCTGC
GTGCTCAACTGGTTCGGCGACTGGTCGGACCAGGCCCTCTTCCAGGTCGGCCACGAGCTGACGCAGTCGGTCGAC
CTGGACCGCGCCGGCTACCGGGCGCCGGACGCGATCCCGGTCGCCTACCGCGGGCTCGCGCTGCCGCCGTCGCAC
CGCGAGGCCGTCGTCAACGCCATGGTGCACATACACTACTCGCTCCGCCGCTACAACGAGCGGCTGCAGCGGCAG
CAGAAGCGGACGACGTTCCTGACGCCGCGCCACTTCCTCGACTTCGTCGGCCAGTACGTCCGCCTCTACAACGAG
AAGCGCGAGGACCTCGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTGGAGAAGCTGCGCGACACGGTCGACAAG
GTGCGCGACCTGCGGGCCAGCCTGGCGGAGAAGAAGACGCGGCTGGAGCAGAAGGACGCCGAGGCCAACGAGAAG
CTGCAGCGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGCAAGAACACGTCGCTCGAGATCCAGGCGGCGCTC
GAGCGGCAGGAGGCCGAGGTGGCGACGCGGCGCCGCGTCGTGCTCGAGGACCTGGCCCGCGCCGAGCCGGCGGTG
GAGGAAGCCAAGGCGAGCGTCAGCAACATCAAGCGGCAGCACCTGACGGAGGTGCGGTCGATGGGCAACCCGCCG
CAGGGCGTGCGGCTGGCGCTCGACGCCGTCTGCACCCTGCTCGGGCACCGCATCAACGACTGGAAGGCGGTGCAG
GCGGTGGTGCGGCGCGACGACTTCATCGCCAGCATCATCATGTTCGACAACGCGCGCCAGATGACGCGGCCGCTG
CGCGTCAAGATGCGCAACGACTTCCTCTCGAACCCCGAGTTCACCTTCGAGAAGGTGAACCGGGCGTCCAAGGCG
TGCGGCCCGCTGGTGCAGTGGGTGGCGGCGCAGGTCAACTACTCGGACATACTCGACCGCGTCGGCCCGCTCAAG
GACGAGGTGGCGCAGCTGGAGGAGCAGGCGCTGCAGACCAAGGCGGAGGCGCGGGCGGTCGAGGGCAACATCGCG
GCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCGCTCATCAGCGAGACGCAGGCGATCAAGGCG
GAGATGGCGACGGTGCAGTTCAAGGTGGACCGCAGCGTGCGGCTGCTCGACAGCCTGTCGTCGGAGCGGACGCGC
TGGGAGGAGGGCAGCCGGTCCTTCGAGACGCAGATCGGCACGCTCGTCGGCGACGTGCTCGTCGCGGCCGCCTTC
CTGGCCTACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCGATGATGGACGACTGGTGCCACCAGCTGCACCTG
TCGGGCATCGAGTACAAGTCGCCGAACCCGGTGACGGAGTACCTGTCGAGCGCGGACGAGCGGCTCGGCTGGCAG
GAGAACACGCTGCCGGTGGACGACCTTTGCACGGAGAACGCCATCATCCTGCGGCGCTTCAACCGGTACCCGCTC
ATCATCGACCCGTCGGGGCGGGTGACGGAGTTCCTGCAGCGCGAGTGCCGCGACCGGCGGCTGACGGTGACGAGC
TTCCTCGACGACACCTTCACCAAGCAGCTCGAGAGCTCGCTGCGCTTCGGCAACCCGATCCTGATCCAGGACGCC
GAGCACCTGGACCCGATCCTCAACCACGTGCTCAACAAGGAGTACCAGCGGACGGGCGGGCGGGTGCTGATCCAG
CTGGGGCGGCAGGAGATCGACTTCTCGCCCTCGTTCCGGCTCTACCTGTCGACGCGGGACCCGTCGGCGCAGTTC
GCGCCCGACATCTGCAGCCGGACGACGTTTGTCAACTTCACGGTGACCAAGAGCAGCCTGCAGACGCAGTCGCTC
AACGACGTGCTCAAGTCGGAGCGGCCGGACGTGGACGAGCGGCGGACGAACCTGATCAAGCTGCAGGGCGAGTTC
AAGGTGCACCTGCGGCAGCTGGAGAAGCAGCTGCTGCAGGCGCTCAACGAGTCGCGCGGCAACATACTCGACGAC
GACAACGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCGGCCGACATCTCGGCCAAGATGGGCCGGACCGAG
GGCGTCATGGCCGAGGTGGAGGAGATCACGCGGCAGTACGGCGTCATCGCCAACTCGTGCAGCGCCGTCTTCGCC
GTGCTGGACCAGCTGCACTTCCTCAACCACTTCTACCAGTTCTCGCTGCAGTACTTCCTCGACATCTTCCGCGCC
GTCCTCGACCCGGGCCGCAACGAGCGGCTGGCGGCGGCCGGGGGCGACCACAACGCGCGGCGCGACATCATTGTG
CGCGACCTGTTCGTCGCCACCTTCCGCCGCACGGCGCTCGGCCTGCTGCAGAAGGACCGGATCACGCTGGCGATG
CTGCTGGCGCAGGCGTCGCCGTACCGGATGGACAAGTCGCTCATCGACCTCGTGCTCGACGACCGGGTCGAGGGC
CGGGACCTGTCGACGTCGTCGTCGTCGTCGTCCCACCCAGACGACGCCGCGGCGGCGGCGGCGGCGGCGCGGGAG
GCCATCGAGGCGCGCAGGAAGCTGTGGCACAGCAGCGAGCCGGCGACGCTGACGTTGAGGCAGTCCATGGTGCTG
CTCGGGGCCCAGCACGGTATCGTCACCTGCTGGCCGACGACGCTCTTCAGCTGGTCCGAGATGCCGTGGCCCTCG
TTGCCGACGACGAGCACGCACGGGTGCTGCCGCAGCGGGTCCTCCCGCTCGATCTGCTCCAGCGGCACGAAGTGG
TCGCTGCCGTACTTCCTCAGCGCCTTCCGGCCCGGCGGCGGCACCGCCGCGTACGTCTTCCACCCGGCCAGCTTC
GACTCCTCGAGGAAGTGGTAG
Transcript >Hirsu2|2896
CTGCAGAGCAAGGCCGTCTCCCTCATCCACATCCACGCCACCGTCGAGCAGGCCCTCGCCGAGCTCGGCACCTGC
CCCTACGACGCCCCGGCCTTCCAGTCGCGCCTCGGCACCGTCCAGGCCGCCGTCGACCAGCTGAACCTGGAGCAG
TACGTCAACCTCGACTTCTGGGTCCGCGGCCTGAACCACAAGATCCAGTCCATCCTGCTCGAGCGCCTGCACGGC
GCCATCCAGGCCTGGATCGCCGCCTTCGAGGACGAGACGCCGGACGAGGGCCGGCGGAGGCGGTCGACGGGCGAG
GGCTGGGAGGGCGAGGGCGAGGGGGGCGGGAGCAACAACGGCAACAGCAACAATAACGGCCACAACGGAAACAGC
GACAACAACAACAACAACAAGCCGAGCGGGCCGACGATGAAGCGCCTGGTTCTCGAGCTGGCGATGCGGAACCAG
GTCATCTACCTCGACCCCCCGCTCGAGTACGCGAGGGCCGGCTGGTTCCTCCACCTCCACGACTGGCTCGGCATC
GTCTGCGACCTCCGCAAGATCAAGGCCGCGCGCTACCGGATGAGCCTCGCCACCGCCGGCGCCGGCGGGGGCGGC
GGCGGCGCCGACGAGCCGCGCTTCACGGACCTGGCCACCGAGTGCGCCGCCGCGCTCCACCGCGTCTACGTGTCG
GTGGAGAGGAAGCTCGGCGAGGTCAGCGCCTACGTCGACAAGTGGCTCCAGTTCCAGTCGCTCTGGGACCTCCAG
TCGGAGCAGGTCTACGACATGCTGGGCGACCACCTCCCGCGCTGGCTCGAGTGCCTGCAGGACATCCGCAAGGTG
CGCACCACCTTCGACACGCAGGAGGTCAGCCGCTCCTTCGGCCACATCACCATCGACTACGACCAGGTCCAGACC
AAGGTCAACGCCAAGTACGACCAGTGGCAGCACGAGATCCTCGTCAAGTTCGCCGGCCGGCTGGGCAACCGCATG
CGCGACGTGCACGCCGAGATCGAGAAGGCGCGCCGGCACCTCGAGGGCCAGAGCTCCGACACGTCGTCGACGGCC
CAGGCCGTCCAGTTCATCACGGCCGTCCAGAGCTGCCGGCGCAACGTCAAGCTGTGGGCGCCCGAGATCGACATG
TTCCGCCAGGGGCAGTCGACGCTCGTCCGCCAGCGCTACCACTTCCCGGCCGACTGGCTGCACATCGAGCAGATC
GACAGCCAGTGGGAGGCTCTCAAGGAGATACTGGAGAAGAAGGCGCGCGTCATGGAGGAGCAGTCGGACGCGATG
CGCGCCAACATCGCCGCCCAGGACAAGCTGGTCAACGAGCGCATCGCCGAGGTCGTGGCCCGGTGGAACGAGGAG
AAGCCGGTGTCGGGCACGATCCAGCCCGACGTCGCCTCGGCCACGCTGGCCTCGTTCGAGTCGCGCATCGCCGGC
CTGCAGGACGACTTCCTGCAGGTCGTCAAGGCCAAGGAGGCCCTCGACCTGCCCGCCTCGCAGGACCGGTCGCTG
GAGGCGACGCTCGAGGAGGTGCGCGACTTCCAGTCCGTCTGGTCCAGCCTGTCGACCATCTGGGCCGGCCTCAAC
GAGACGCGCGACGTGCTGTGGACGGCCGTCCAGCCGCGCAAGGTGCGCGCCAAGGTGGACGACCTGATCAAGAGC
ACCAAGGAGATGCCGAGCCGGATGCGGCAGTACGCCGCCTTCGAGCACGTCCAGGGCATCCTCCGCGGCTTCCTC
AAGGTCAACCCCATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGCCACTGGCACAAGATCTACAAGCAG
CTCCGGCCGCAGAAGCGCTTCTCCCCGAGCTCCATGACGCTCGGCGACGTCTGGGACCTGAACCTGGTGGCGACC
GAGGCCGTCGTCAAGGACATCATCGCCCAGGCCCAGGGCGAGATGGCGCTCGAGGAGTTCCTGAAGCAGGTGCGC
GAGACGTGGCAGAACTACGCGCTCGAGATGGTCGGCTACCAGAACAAGTGCCGCCTCATCCGCGGCTGGGACGAC
CTGTTCGCCAAGTGCAGCGAGAACCTCAACTCGCTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAG
GAGGAGGCCGTCGCGTGGGAGGACAAGCTGAACCGCGTCCACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGC
CAGTGGGTCTACCTCGAGGGCGTCTTCACCGGCAACGCCGACATCAAGCACCTGCTGCCCATCGAGTCGGGCCGC
TTCCAGAACATCAACAGCGAGTTCCTGGCCGTCATGAAGAAGGCCAACAAGACGCCCTACGTGCTCGACGTCCTC
AACATACCCAACGCCCAGAAGTCGCTCGAGCGCCTGGCCGAGATGCTCAACAAGATACAGAAGGCGCTGGGCGAG
TACCTCGAGAAGGAGCGCGTCTCGTTCCCGCGCTTCTACTTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGC
AACAGCAACGACACGCTGCGCATCGCCAAGCACTTCAAGAAGATGTTCGCCGGCCTGTCCGGCCTCGTCATGGAC
GACGAGTCCGTCATCTCGGGCTTCACCTCCAAGGAGGGCGAGACGGTCAAGCTGAAGCGGGACATCTCCCTGGCC
AAGACGCCGAGGATCAACGACTGGCTCGCCCTGCTCGAGGGCGGCATGAAGGCGACGCTGGCCGAGCTGCTGGCC
GAGGCCGTCGCCCGCTACGCGCCCGTCCTCGAGGCGAGCGCCGTCGACGCCGCCGCGCTGAGGCGCTTCATGGAC
GACTTCCCCAGCCAGATCGTCGTCCTGGCCACCCAGGTGGCCTGGACGACGGCCGTCGACGCGGCCCTGGCCGCC
GGCGGCGGCGGCGCGCTGCGGGCCCTGCTCGAGCGCGAGGTCCAGGTGCTGCGCGTCCTCGCCGACACGGTGCTC
GGCGACCTCGAGGTGATCCTGCGCAAGAAGTGCGAGCAGCTGATCACCGAGTGCGTCCACCAGCGCGACGCCATC
GAGAGGCTCGTCGCCGCCGGCGCCGACTCGCCCGGCCACCACCTGTGGCAGCTCCAGATGCGCTACGTCTACACG
CCCGAGGGCGCCCCCCTCGACCGCCTCCACGTCCGGATGGCCAACGCCCGGCTCAACTACGGCTTCGAGTACCTC
GGCGTCCCGGACCGCCTCGTGCGGACGCCGCTGACGGACCGCTGCTTCCTCACCCTGACCCAGGCCCTCTGCCAG
CGCCTCGGCGGCTCGCCCTACGGCCCGGCCGGCACGGGCAAGACGGAGTCGGTCAAGGCGCTGGGCGTCCAGCTC
GGCCGCTTCACCCTCGTCTTCTGCTGCGACGACACGTTCGACTTCCAGGCCATGGGCCGCATCTTCCTCGGCATC
TGCCAGGTCGGCGCCTGGGGCTGCTTCGACGAGTTTAACCGGCTCGAGGAGAGGATCCTGTCGGCCGTCTCGCAG
CAGATCCAGAACATCCAGCTCGGCCTCAAGCAGGGCGCCGAGGACAGCAAGTCGCAGATCGAGCTGGTCGGCCGC
CAGCTCGCCGTCAACGAGAACACGGGCATCTTCATCACGATGAACCCCGGCTACGCCGGCCGCTCCAACCTGCCC
GACAACCTCAAGAAGCTGTTCCGGAGCGTGGCCATGTCGAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTC
TACTCGCAGGGCTTCAACCGGGCCAAGGAGCTCTCCAAGCAGACCGTCCCCTTCTTCGACCAGTGCGCCGGCCAG
CTGTCCCGGCAGGCGCACTACGACTTTGGCCTGCGCGCCCTCAAGAGCGTCCTCGTCAGCTCGGGGGGGCTGAAG
CGCGCCCGCCTCAACAACGACGACGACGACGGCGACGGCGGCGGCGGCGGCGGCGGCGGCGGGGCCGAGCAGGTC
GTCGTCGAGCCCGAGATCATCGTGCAGAGCATCCGCGAGACCATCGCCCCGAAGCTGATCAAGGCCGACGTCGAC
ATCATGACGGGCATCGAGGCGCGGTGCTTCCCCGGCGTCCGGTACGTGCCGGCCAACCTCGAGGCGCTGGAGGGG
GCGGTGCGCGCGCTCGCGGCGGAGCGGCACCTGGTCGTCACGGACACGTGGATGACCAAGGTGCTCCAGCTGTAC
CAGATCCAGAAGATCCACCACGGCGTCATGATGGTGGGCAACTCGGGCAGCGGCAAGTCGGCCGCCTGGCGGCTG
CTGCTCGACGCCCTCCAGCGGGTCGAGGGCGTCGAGGGCGTCTCGCACGTCATCGACTCCAAGGTCATGTCCAAG
GAGGCCCTCTACGGCCACCTCGACCCGACGACGCGCGAGTGGACCGACGGCCTCTTCACCAGCATCCTCCGCAAG
ATCGTCGACAACCTCCGCGGCGAGGACGCCAAGCGGCACTGGATCGTCTTCGACGGCGACGTCGACCCGGAGTGG
GTCGAGAACCTGAACAGCGTCCTCGACGACAACAAGCTGCTGACGCTGCCCAACGGCGAGCGGCTGAACCTGCCG
GCCAACGTGCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCCACGCTCGCCACCGTCAGCCGGTGCGGCATG
GTCTGGTTCAGCGAGGACACGGTGACGCCGAGCATGCTGGTGGCCAACTACCTCGAGACGCTCGGCAGCGTCCCC
TTCGAGGACCTGGACGAGGACAGCGTCGCGACGGGGCAGGCGGCGGCCCGGATCCTGGCCGTGCAGGGCCAGGTG
GCGGACCTGCTGCGGGCGTACCTGACGTCGGACGGCTTCGTGCTCGAGGCGCTGGAGCGGGCCCGCGGCTACGGC
CACATCATGGAGTTCACCGTCGCCCGCGTCCTCACCACGCTCTTCTCCCTGCTCAACAAGGCGGTCCGGGACGTG
ATCGAGTACAACGGCCGGCACCCGGACTTCCCGCTCGACGCGGAGCAGGTCGAGGCCTTCGTGCCCAAGAAGCTG
CTGCTCGCCCTCGTCTGGGCCCTGACGGGCGACTGCCCGCTGGCGGACCGCAAGGCCTTCGGCGACGACGTCTGC
GCCCTGGCCGGCTTCGGCTCGCCGCCGCCCGAGGCGGCGGGCGGCGCCGGCTCGCTCATCGACTACGACGTGAGC
CTGCCGCGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCGACCATCGAGGTCAACACGCACTCGGTCACGCAG
ACGGACGTGGTGATCCCGACGCTGGACACGGTCCGGCACGAGGACGTGCTCTACTCGTGGCTCGCCGAGCACAAG
CCGCTGCTGCTGTGCGGGCCGCCCGGCTCGGGCAAGACGATGACGCTCTTCAGCGCGCTGCGCAAGCTGCCCAAC
ATGGAGGTGGTCGGCCTCAACTTCTCGAGCGCGACGACGCCCGACCTCCTGATCAAGACGTTCGAGCAGTACTGC
GAGTACAAGAAGACGCTCAACGGGGTGACGCTGTCGCCGACGCAGATCGGCCGCTGGCTCGTCGTCTTCTGCGAC
GAGATCAACCTGCCGGCGCCGGACAACTACGGGACGCAGCGGGCCATCTCCTTCCTGCGCCAGCTGGTCGAGCAC
AACGGCTTCTGGCGCACGTCGGACCGGTCGTGGGTCGCGCTGGACCGCATCCAGTTCGTCGGCGCCTGCAACCCG
CCGACGGACGCCGGGCGCACGCCGCTGGGCGCGCGCTTCCTGCGCCACGCGCCCCTCGTCATGGTCGACTACCCG
GGCGAGCAGTCGCTCGGCCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAGGTGGTGCCGTCGCTGCGCGGC
TACGCCGAGCCGCTGACGAGCGCCATGGTGCGCCTCTACCTCGAGTCGCAGCGGCGCTTCACGCCCCGGATCCAG
CCGCACTACGTCTACAGCCCGCGCGAGCTGACGCGCTGGGTGCGCGGCGTCTACGAGGCCATCCGGCCGCTCGAG
GCGCTCTCGGTCGAGGGCCTGGTCCGCATCTGGGCCCACGAGGCGCTCCGGCTCTTCCAGGACCGGCTCGTGGCC
GAGGAGGAGCGGGCGTGGACGGAGGAGGCGGTCCGGCGCATCGCCCTCGACTGCTTCCCCACCGTCGACGAGGAG
CGGGCGCTGGGCGGGCCCATCCTCTTCTCCAACTGGCTGTCGAGGAACTACGTGCCGGTGGACCGCGAGCAGCTG
CGCGACTTCGTCAAGGCGCGGCTGCGGACCTTTTGCGAGGAGGAGGTGGACGTGCCGCTGATACTGTTCAACGAC
GTGCTCGAGCACGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGCCACCTGATACTGATCGGCGTCAGC
GGCAGCGGCAAGACGACGCTCTCGCGCTTCGTGGCCTGGATGAACGGCCTCAAGGTCTTCCAGATCAAGGTGCAC
GGCCGGTACTCGGGCGACGACTTCGACGAGGACCTGCGCGACGTGCTCCGCCGCTGCGGCTGCAAGGGCGAGAAG
ATGTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCCTCGAGCGCATGAACACGCTGCTCGCCAAC
GCCGAGGTGCCCGGCCTGTTCGAGGGCGACGACTACGCCGCCCTGATGACGGCCTGCAAGGAGGGCGCGCAGCGG
CAGAACCTGCACCTGGACTCGCCCGAGGAGCTGTACCGCTGGTTCACGCAGCAGATCGTCAGCAACCTGCACGTC
GTCTTCACCATGAACCCGCCCGAGGGCGGGCTGTCGTCCAAGGCGGCGACGAGCCCGGCCCTCTTCAACCGCTGC
GTGCTCAACTGGTTCGGCGACTGGTCGGACCAGGCCCTCTTCCAGGTCGGCCACGAGCTGACGCAGTCGGTCGAC
CTGGACCGCGCCGGCTACCGGGCGCCGGACGCGATCCCGGTCGCCTACCGCGGGCTCGCGCTGCCGCCGTCGCAC
CGCGAGGCCGTCGTCAACGCCATGGTGCACATACACTACTCGCTCCGCCGCTACAACGAGCGGCTGCAGCGGCAG
CAGAAGCGGACGACGTTCCTGACGCCGCGCCACTTCCTCGACTTCGTCGGCCAGTACGTCCGCCTCTACAACGAG
AAGCGCGAGGACCTCGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTGGAGAAGCTGCGCGACACGGTCGACAAG
GTGCGCGACCTGCGGGCCAGCCTGGCGGAGAAGAAGACGCGGCTGGAGCAGAAGGACGCCGAGGCCAACGAGAAG
CTGCAGCGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGCAAGAACACGTCGCTCGAGATCCAGGCGGCGCTC
GAGCGGCAGGAGGCCGAGGTGGCGACGCGGCGCCGCGTCGTGCTCGAGGACCTGGCCCGCGCCGAGCCGGCGGTG
GAGGAAGCCAAGGCGAGCGTCAGCAACATCAAGCGGCAGCACCTGACGGAGGTGCGGTCGATGGGCAACCCGCCG
CAGGGCGTGCGGCTGGCGCTCGACGCCGTCTGCACCCTGCTCGGGCACCGCATCAACGACTGGAAGGCGGTGCAG
GCGGTGGTGCGGCGCGACGACTTCATCGCCAGCATCATCATGTTCGACAACGCGCGCCAGATGACGCGGCCGCTG
CGCGTCAAGATGCGCAACGACTTCCTCTCGAACCCCGAGTTCACCTTCGAGAAGGTGAACCGGGCGTCCAAGGCG
TGCGGCCCGCTGGTGCAGTGGGTGGCGGCGCAGGTCAACTACTCGGACATACTCGACCGCGTCGGCCCGCTCAAG
GACGAGGTGGCGCAGCTGGAGGAGCAGGCGCTGCAGACCAAGGCGGAGGCGCGGGCGGTCGAGGGCAACATCGCG
GCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCGCTCATCAGCGAGACGCAGGCGATCAAGGCG
GAGATGGCGACGGTGCAGTTCAAGGTGGACCGCAGCGTGCGGCTGCTCGACAGCCTGTCGTCGGAGCGGACGCGC
TGGGAGGAGGGCAGCCGGTCCTTCGAGACGCAGATCGGCACGCTCGTCGGCGACGTGCTCGTCGCGGCCGCCTTC
CTGGCCTACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCGATGATGGACGACTGGTGCCACCAGCTGCACCTG
TCGGGCATCGAGTACAAGTCGCCGAACCCGGTGACGGAGTACCTGTCGAGCGCGGACGAGCGGCTCGGCTGGCAG
GAGAACACGCTGCCGGTGGACGACCTTTGCACGGAGAACGCCATCATCCTGCGGCGCTTCAACCGGTACCCGCTC
ATCATCGACCCGTCGGGGCGGGTGACGGAGTTCCTGCAGCGCGAGTGCCGCGACCGGCGGCTGACGGTGACGAGC
TTCCTCGACGACACCTTCACCAAGCAGCTCGAGAGCTCGCTGCGCTTCGGCAACCCGATCCTGATCCAGGACGCC
GAGCACCTGGACCCGATCCTCAACCACGTGCTCAACAAGGAGTACCAGCGGACGGGCGGGCGGGTGCTGATCCAG
CTGGGGCGGCAGGAGATCGACTTCTCGCCCTCGTTCCGGCTCTACCTGTCGACGCGGGACCCGTCGGCGCAGTTC
GCGCCCGACATCTGCAGCCGGACGACGTTTGTCAACTTCACGGTGACCAAGAGCAGCCTGCAGACGCAGTCGCTC
AACGACGTGCTCAAGTCGGAGCGGCCGGACGTGGACGAGCGGCGGACGAACCTGATCAAGCTGCAGGGCGAGTTC
AAGGTGCACCTGCGGCAGCTGGAGAAGCAGCTGCTGCAGGCGCTCAACGAGTCGCGCGGCAACATACTCGACGAC
GACAACGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCGGCCGACATCTCGGCCAAGATGGGCCGGACCGAG
GGCGTCATGGCCGAGGTGGAGGAGATCACGCGGCAGTACGGCGTCATCGCCAACTCGTGCAGCGCCGTCTTCGCC
GTGCTGGACCAGCTGCACTTCCTCAACCACTTCTACCAGTTCTCGCTGCAGTACTTCCTCGACATCTTCCGCGCC
GTCCTCGACCCGGGCCGCAACGAGCGGCTGGCGGCGGCCGGGGGCGACCACAACGCGCGGCGCGACATCATTGTG
CGCGACCTGTTCGTCGCCACCTTCCGCCGCACGGCGCTCGGCCTGCTGCAGAAGGACCGGATCACGCTGGCGATG
CTGCTGGCGCAGGCGTCGCCGTACCGGATGGACAAGTCGCTCATCGACCTCGTGCTCGACGACCGGGTCGAGGGC
CGGGACCTGTCGACGTCGTCGTCGTCGTCGTCCCACCCAGACGACGCCGCGGCGGCGGCGGCGGCGGCGCGGGAG
GCCATCGAGGCGCGCAGGAAGCTGTGGCACAGCAGCGAGCCGGCGACGCTGACGTTGAGGCAGTCCATGGTGCTG
CTCGGGGCCCAGCACGGTATCGTCACCTGCTGGCCGACGACGCTCTTCAGCTGGTCCGAGATGCCGTGGCCCTCG
TTGCCGACGACGAGCACGCACGGGTGCTGCCGCAGCGGGTCCTCCCGCTCGATCTGCTCCAGCGGCACGAAGTGG
TCGCTGCCGTACTTCCTCAGCGCCTTCCGGCCCGGCGGCGGCACCGCCGCGTACGTCTTCCACCCGGCCAGCTTC
GACTCCTCGAGGAAGTGGTAG
Gene >Hirsu2|2896
CTGCAGAGCAAGGCCGTCTCCCTCATCCACATCCACGCCACCGTCGAGCAGGCCCTCGCCGAGCTCGGCACCTGC
CCCTACGACGCCCCGGCCTTCCAGTCGCGCCTCGGCACCGTCCAGGCCGCCGTCGACCAGCTGAACCTGGAGCAG
TACGTCAACCTCGACTTCTGGGTCCGCGGCCTGAACCACAAGATCCAGTCCATCCTGCTCGAGCGCCTGCACGGC
GCCATCCAGGCCTGGATCGCCGCCTTCGAGGACGAGACGCCGGACGAGGGCCGGCGGAGGCGGTCGACGGGCGAG
GGCTGGGAGGGCGAGGGCGAGGGGGGCGGGAGCAACAACGGCAACAGCAACAATAACGGCCACAACGGAAACAGC
GACAACAACAACAACAACAAGCCGAGCGGGCCGACGATGAAGCGCCTGGTTCTCGAGCTGGCGATGCGGAACCAG
GTCATCTACCTCGACCCCCCGCTCGAGTACGCGAGGGCCGGCTGGTTCCTCCACCTCCACGACTGGCTCGGCATC
GTCTGCGACCTCCGCAAGATCAAGGCCGCGCGCTACCGGATGAGCCTCGCCACCGCCGGCGCCGGCGGGGGCGGC
GGCGGCGCCGACGAGCCGCGCTTCACGGACCTGGCCACCGAGTGCGCCGCCGCGCTCCACCGCGTCTACGTGTCG
GTGGAGAGGAAGCTCGGCGAGGTCAGCGCCTACGTCGACAAGTGGCTCCAGTTCCAGTCGCTCTGGGACCTCCAG
TCGGAGCAGGTCTACGACATGCTGGGCGACCACCTCCCGCGCTGGCTCGAGTGCCTGCAGGACATCCGCAAGGTG
CGCACCACCTTCGACACGCAGGAGGTCAGCCGCTCCTTCGGCCACATCACCATCGACTACGACCAGGTCCAGACC
AAGGTCAACGCCAAGTACGACCAGTGGCAGCACGAGATCCTCGTCAAGTTCGCCGGCCGGCTGGGCAACCGCATG
CGCGACGTGCACGCCGAGATCGAGAAGGCGCGCCGGCACCTCGAGGGCCAGAGCTCCGACACGTCGTCGACGGCC
CAGGCCGTCCAGTTCATCACGGCCGTCCAGAGCTGCCGGCGCAACGTCAAGCTGTGGGCGCCCGAGATCGACATG
TTCCGCCAGGGGCAGTCGACGCTCGTCCGCCAGCGCTACCACTTCCCGGCCGACTGGCTGCACATCGAGCAGATC
GACAGCCAGTGGGAGGCTCTCAAGGAGATACTGGAGAAGAAGGCGCGCGTCATGGAGGAGCAGTCGGACGCGATG
CGCGCCAACATCGCCGCCCAGGACAAGCTGGTCAACGAGCGCATCGCCGAGGTCGTGGCCCGGTGGAACGAGGAG
AAGCCGGTGTCGGGCACGATCCAGCCCGACGTCGCCTCGGCCACGCTGGCCTCGTTCGAGTCGCGCATCGCCGGC
CTGCAGGACGACTTCCTGCAGGTCGTCAAGGCCAAGGAGGCCCTCGACCTGCCCGCCTCGCAGGACCGGTCGCTG
GAGGCGACGCTCGAGGAGGTGCGCGACTTCCAGTCCGTCTGGTCCAGCCTGTCGACCATCTGGGCCGGCCTCAAC
GAGACGCGCGACGTGCTGTGGACGGCCGTCCAGCCGCGCAAGGTGCGCGCCAAGGTGGACGACCTGATCAAGAGC
ACCAAGGAGATGCCGAGCCGGATGCGGCAGTACGCCGCCTTCGAGCACGTCCAGGGCATCCTCCGCGGCTTCCTC
AAGGTCAACCCCATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGCCACTGGCACAAGATCTACAAGCAG
CTCCGGCCGCAGAAGCGCTTCTCCCCGAGCTCCATGACGCTCGGCGACGTCTGGGACCTGAACCTGGTGGCGACC
GAGGCCGTCGTCAAGGACATCATCGCCCAGGCCCAGGGCGAGATGGCGCTCGAGGAGTTCCTGAAGCAGGTGCGC
GAGACGTGGCAGAACTACGCGCTCGAGATGGTCGGCTACCAGAACAAGTGCCGCCTCATCCGCGGCTGGGACGAC
CTGTTCGCCAAGTGCAGCGAGAACCTCAACTCGCTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAG
GAGGAGGCCGTCGCGTGGGAGGACAAGCTGAACCGCGTCCACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGC
CAGTGGGTCTACCTCGAGGGCGTCTTCACCGGCAACGCCGACATCAAGCACCTGCTGCCCATCGAGTCGGGCCGC
TTCCAGAACATCAACAGCGAGTTCCTGGCCGTCATGAAGAAGGCCAACAAGACGCCCTACGTGCTCGACGTCCTC
AACATACCCAACGCCCAGAAGTCGCTCGAGCGCCTGGCCGAGATGCTCAACAAGATACAGAAGGCGCTGGGCGAG
TACCTCGAGAAGGAGCGCGTCTCGTTCCCGCGCTTCTACTTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGC
AACAGCAACGACACGCTGCGCATCGCCAAGCACTTCAAGAAGATGTTCGCCGGCCTGTCCGGCCTCGTCATGGAC
GACGAGTCCGTCATCTCGGGCTTCACCTCCAAGGAGGGCGAGACGGTCAAGCTGAAGCGGGACATCTCCCTGGCC
AAGACGCCGAGGATCAACGACTGGCTCGCCCTGCTCGAGGGCGGCATGAAGGCGACGCTGGCCGAGCTGCTGGCC
GAGGCCGTCGCCCGCTACGCGCCCGTCCTCGAGGCGAGCGCCGTCGACGCCGCCGCGCTGAGGCGCTTCATGGAC
GACTTCCCCAGCCAGATCGTCGTCCTGGCCACCCAGGTGGCCTGGACGACGGCCGTCGACGCGGCCCTGGCCGCC
GGCGGCGGCGGCGCGCTGCGGGCCCTGCTCGAGCGCGAGGTCCAGGTGCTGCGCGTCCTCGCCGACACGGTGCTC
GGCGACCTCGAGGTGATCCTGCGCAAGAAGTGCGAGCAGCTGATCACCGAGTGCGTCCACCAGCGCGACGCCATC
GAGAGGCTCGTCGCCGCCGGCGCCGACTCGCCCGGCCACCACCTGTGGCAGCTCCAGATGCGCTACGTCTACACG
CCCGAGGGCGCCCCCCTCGACCGCCTCCACGTCCGGATGGCCAACGCCCGGCTCAACTACGGCTTCGAGTACCTC
GGCGTCCCGGACCGCCTCGTGCGGACGCCGCTGACGGACCGCTGCTTCCTCACCCTGACCCAGGCCCTCTGCCAG
CGCCTCGGCGGCTCGCCCTACGGCCCGGCCGGCACGGGCAAGACGGAGTCGGTCAAGGCGCTGGGCGTCCAGCTC
GGCCGCTTCACCCTCGTCTTCTGCTGCGACGACACGTTCGACTTCCAGGCCATGGGCCGCATCTTCCTCGGCATC
TGCCAGGTCGGCGCCTGGGGCTGCTTCGACGAGTTTAACCGGCTCGAGGAGAGGATCCTGTCGGCCGTCTCGCAG
CAGATCCAGAACATCCAGCTCGGCCTCAAGCAGGGCGCCGAGGACAGCAAGTCGCAGATCGAGCTGGTCGGCCGC
CAGCTCGCCGTCAACGAGAACACGGGCATCTTCATCACGATGAACCCCGGCTACGCCGGCCGCTCCAACCTGCCC
GACAACCTCAAGAAGCTGTTCCGGAGCGTGGCCATGTCGAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTC
TACTCGCAGGGCTTCAACCGGGCCAAGGAGCTCTCCAAGCAGACCGTCCCCTTCTTCGACCAGTGCGCCGGCCAG
CTGTCCCGGCAGGCGCACTACGACTTTGGCCTGCGCGCCCTCAAGAGCGTCCTCGTCAGCTCGGGGGGGCTGAAG
CGCGCCCGCCTCAACAACGACGACGACGACGGCGACGGCGGCGGCGGCGGCGGCGGCGGCGGGGCCGAGCAGGTC
GTCGTCGAGCCCGAGATCATCGTGCAGAGCATCCGCGAGACCATCGCCCCGAAGCTGATCAAGGCCGACGTCGAC
ATCATGACGGGCATCGAGGCGCGGTGCTTCCCCGGCGTCCGGTACGTGCCGGCCAACCTCGAGGCGCTGGAGGGG
GCGGTGCGCGCGCTCGCGGCGGAGCGGCACCTGGTCGTCACGGACACGTGGATGACCAAGGTGCTCCAGCTGTAC
CAGATCCAGAAGATCCACCACGGCGTCATGATGGTGGGCAACTCGGGCAGCGGCAAGTCGGCCGCCTGGCGGCTG
CTGCTCGACGCCCTCCAGCGGGTCGAGGGCGTCGAGGGCGTCTCGCACGTCATCGACTCCAAGGTCATGTCCAAG
GAGGCCCTCTACGGCCACCTCGACCCGACGACGCGCGAGTGGACCGACGGCCTCTTCACCAGCATCCTCCGCAAG
ATCGTCGACAACCTCCGCGGCGAGGACGCCAAGCGGCACTGGATCGTCTTCGACGGCGACGTCGACCCGGAGTGG
GTCGAGAACCTGAACAGCGTCCTCGACGACAACAAGCTGCTGACGCTGCCCAACGGCGAGCGGCTGAACCTGCCG
GCCAACGTGCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCCACGCTCGCCACCGTCAGCCGGTGCGGCATG
GTCTGGTTCAGCGAGGACACGGTGACGCCGAGCATGCTGGTGGCCAACTACCTCGAGACGCTCGGCAGCGTCCCC
TTCGAGGACCTGGACGAGGACAGCGTCGCGACGGGGCAGGCGGCGGCCCGGATCCTGGCCGTGCAGGGCCAGGTG
GCGGACCTGCTGCGGGCGTACCTGACGTCGGACGGCTTCGTGCTCGAGGCGCTGGAGCGGGCCCGCGGCTACGGC
CACATCATGGAGTTCACCGTCGCCCGCGTCCTCACCACGCTCTTCTCCCTGCTCAACAAGGCGGTCCGGGACGTG
ATCGAGTACAACGGCCGGCACCCGGACTTCCCGCTCGACGCGGAGCAGGTCGAGGCCTTCGTGCCCAAGAAGCTG
CTGCTCGCCCTCGTCTGGGCCCTGACGGGCGACTGCCCGCTGGCGGACCGCAAGGCCTTCGGCGACGACGTCTGC
GCCCTGGCCGGCTTCGGCTCGCCGCCGCCCGAGGCGGCGGGCGGCGCCGGCTCGCTCATCGACTACGACGTGAGC
CTGCCGCGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCGACCATCGAGGTCAACACGCACTCGGTCACGCAG
ACGGACGTGGTGATCCCGACGCTGGACACGGTCCGGCACGAGGACGTGCTCTACTCGTGGCTCGCCGAGCACAAG
CCGCTGCTGCTGTGCGGGCCGCCCGGCTCGGGCAAGACGATGACGCTCTTCAGCGCGCTGCGCAAGCTGCCCAAC
ATGGAGGTGGTCGGCCTCAACTTCTCGAGCGCGACGACGCCCGACCTCCTGATCAAGACGTTCGAGCAGTACTGC
GAGTACAAGAAGACGCTCAACGGGGTGACGCTGTCGCCGACGCAGATCGGCCGCTGGCTCGTCGTCTTCTGCGAC
GAGATCAACCTGCCGGCGCCGGACAACTACGGGACGCAGCGGGCCATCTCCTTCCTGCGCCAGCTGGTCGAGCAC
AACGGCTTCTGGCGCACGTCGGACCGGTCGTGGGTCGCGCTGGACCGCATCCAGTTCGTCGGCGCCTGCAACCCG
CCGACGGACGCCGGGCGCACGCCGCTGGGCGCGCGCTTCCTGCGCCACGCGCCCCTCGTCATGGTCGACTACCCG
GGCGAGCAGTCGCTCGGCCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAGGTGGTGCCGTCGCTGCGCGGC
TACGCCGAGCCGCTGACGAGCGCCATGGTGCGCCTCTACCTCGAGTCGCAGCGGCGCTTCACGCCCCGGATCCAG
CCGCACTACGTCTACAGCCCGCGCGAGCTGACGCGCTGGGTGCGCGGCGTCTACGAGGCCATCCGGCCGCTCGAG
GCGCTCTCGGTCGAGGGCCTGGTCCGCATCTGGGCCCACGAGGCGCTCCGGCTCTTCCAGGACCGGCTCGTGGCC
GAGGAGGAGCGGGCGTGGACGGAGGAGGCGGTCCGGCGCATCGCCCTCGACTGCTTCCCCACCGTCGACGAGGAG
CGGGCGCTGGGCGGGCCCATCCTCTTCTCCAACTGGCTGTCGAGGAACTACGTGCCGGTGGACCGCGAGCAGCTG
CGCGACTTCGTCAAGGCGCGGCTGCGGACCTTTTGCGAGGAGGAGGTGGACGTGCCGCTGATACTGTTCAACGAC
GTGCTCGAGCACGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGCCACCTGATACTGATCGGCGTCAGC
GGCAGCGGCAAGACGACGCTCTCGCGCTTCGTGGCCTGGATGAACGGCCTCAAGGTCTTCCAGATCAAGGTGCAC
GGCCGGTACTCGGGCGACGACTTCGACGAGGACCTGCGCGACGTGCTCCGCCGCTGCGGCTGCAAGGGCGAGAAG
ATGTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCCTCGAGCGCATGAACACGCTGCTCGCCAAC
GCCGAGGTGCCCGGCCTGTTCGAGGGCGACGACTACGCCGCCCTGATGACGGCCTGCAAGGAGGGCGCGCAGCGG
CAGAACCTGCACCTGGACTCGCCCGAGGAGCTGTACCGCTGGTTCACGCAGCAGATCGTCAGCAACCTGCACGTC
GTCTTCACCATGAACCCGCCCGAGGGCGGGCTGTCGTCCAAGGCGGCGACGAGCCCGGCCCTCTTCAACCGCTGC
GTGCTCAACTGGTTCGGCGACTGGTCGGACCAGGCCCTCTTCCAGGTCGGCCACGAGCTGACGCAGTCGGTCGAC
CTGGACCGCGCCGGCTACCGGGCGCCGGACGCGATCCCGGTCGCCTACCGCGGGCTCGCGCTGCCGCCGTCGCAC
CGCGAGGCCGTCGTCAACGCCATGGTGCACATACACTACTCGCTCCGCCGCTACAACGAGCGGCTGCAGCGGCAG
CAGAAGCGGACGACGTTCCTGACGCCGCGCCACTTCCTCGACTTCGTCGGCCAGTACGTCCGCCTCTACAACGAG
AAGCGCGAGGACCTCGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTGGAGAAGCTGCGCGACACGGTCGACAAG
GTGCGCGACCTGCGGGCCAGCCTGGCGGAGAAGAAGACGCGGCTGGAGCAGAAGGACGCCGAGGCCAACGAGAAG
CTGCAGCGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGCAAGAACACGTCGCTCGAGATCCAGGCGGCGCTC
GAGCGGCAGGAGGCCGAGGTGGCGACGCGGCGCCGCGTCGTGCTCGAGGACCTGGCCCGCGCCGAGCCGGCGGTG
GAGGAAGCCAAGGCGAGCGTCAGCAACATCAAGCGGCAGCACCTGACGGAGGTGCGGTCGATGGGCAACCCGCCG
CAGGGCGTGCGGCTGGCGCTCGACGCCGTCTGCACCCTGCTCGGGCACCGCATCAACGACTGGAAGGCGGTGCAG
GCGGTGGTGCGGCGCGACGACTTCATCGCCAGCATCATCATGTTCGACAACGCGCGCCAGATGACGCGGCCGCTG
CGCGTCAAGATGCGCAACGACTTCCTCTCGAACCCCGAGTTCACCTTCGAGAAGGTGAACCGGGCGTCCAAGGCG
TGCGGCCCGCTGGTGCAGTGGGTGGCGGCGCAGGTCAACTACTCGGACATACTCGACCGCGTCGGCCCGCTCAAG
GACGAGGTGGCGCAGCTGGAGGAGCAGGCGCTGCAGACCAAGGCGGAGGCGCGGGCGGTCGAGGGCAACATCGCG
GCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCGCTCATCAGCGAGACGCAGGCGATCAAGGCG
GAGATGGCGACGGTGCAGTTCAAGGTGGACCGCAGCGTGCGGCTGCTCGACAGCCTGTCGTCGGAGCGGACGCGC
TGGGAGGAGGGCAGCCGGTCCTTCGAGACGCAGATCGGCACGCTCGTCGGCGACGTGCTCGTCGCGGCCGCCTTC
CTGGCCTACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCGATGATGGACGACTGGTGCCACCAGCTGCACCTG
TCGGGCATCGAGTACAAGTCGCCGAACCCGGTGACGGAGTACCTGTCGAGCGCGGACGAGCGGCTCGGCTGGCAG
GAGAACACGCTGCCGGTGGACGACCTTTGCACGGAGAACGCCATCATCCTGCGGCGCTTCAACCGGTACCCGCTC
ATCATCGACCCGTCGGGGCGGGTGACGGAGTTCCTGCAGCGCGAGTGCCGCGACCGGCGGCTGACGGTGACGAGC
TTCCTCGACGACACCTTCACCAAGCAGCTCGAGAGCTCGCTGCGCTTCGGCAACCCGATCCTGATCCAGGACGCC
GAGCACCTGGACCCGATCCTCAACCACGTGCTCAACAAGGAGTACCAGCGGACGGGCGGGCGGGTGCTGATCCAG
CTGGGGCGGCAGGAGATCGACTTCTCGCCCTCGTTCCGGCTCTACCTGTCGACGCGGGACCCGTCGGCGCAGTTC
GCGCCCGACATCTGCAGCCGGACGACGTTTGTCAACTTCACGGTGACCAAGAGCAGCCTGCAGACGCAGTCGCTC
AACGACGTGCTCAAGTCGGAGCGGCCGGACGTGGACGAGCGGCGGACGAACCTGATCAAGCTGCAGGGCGAGTTC
AAGGTGCACCTGCGGCAGCTGGAGAAGCAGCTGCTGCAGGCGCTCAACGAGTCGCGCGGCAACATACTCGACGAC
GACAACGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCGGCCGACATCTCGGCCAAGATGGGCCGGACCGAG
GGCGTCATGGCCGAGGTGGAGGAGATCACGCGGCAGTACGGCGTCATCGCCAACTCGTGCAGCGCCGTCTTCGCC
GTGCTGGACCAGCTGCACTTCCTCAACCACTTCTACCAGTTCTCGCTGCAGTACTTCCTCGACATCTTCCGCGCC
GTCCTCGACCCGGGCCGCAACGAGCGGCTGGCGGCGGCCGGGGGCGACCACAACGCGCGGCGCGACATCATTGTG
CGCGACCTGTTCGTCGCCACCTTCCGCCGCACGGCGCTCGGCCTGCTGCAGAAGGACCGGATCACGCTGGCGATG
CTGCTGGCGCAGGCGTCGCCGTACCGGATGGACAAGTCGCTCATCGACCTCGTGCTCGACGACCGGGTCGAGGGC
CGGGACCTGTCGACGTCGTCGTCGTCGTCGTCCCACCCAGACGACGCCGCGGCGGCGGCGGCGGCGGCGCGGGAG
GCCATCGAGGCGCGCAGGAAGCTGTGGCACAGCAGCGAGCCGGCGACGCTGACGTTGAGGCAGTCCATGGTGCTG
CTCGGGGCCCAGCACGGTATCGTCACCTGCTGGCCGACGACGCTCTTCAGCTGGTCCGAGATGCCGTGGCCCTCG
TTGCCGACGACGAGCACGCACGGGTGCTGCCGCAGCGGGTCCTCCCGCTCGATCTGCTCCAGCGGCACGAAGTGG
TCGCTGCCGTACTTCCTCAGCGCCTTCCGGCCCGGCGGCGGCACCGCCGCGTACGTCTTCCACCCGGCCAGCTTC
GACTCCTCGAGGAAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail