Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2893
Gene name
LocationContig_1716:469..5119
Strand+
Gene length (bp)4650
Transcript length (bp)4650
Coding sequence length (bp)4650
Protein length (aa) 1550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00275 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) 8.4E-129 401 828
PF01761 DHQ_synthase 3-dehydroquinate synthase 2.4E-102 77 355
PF01487 DHquinase_I Type I 3-dehydroquinase 1.7E-56 1048 1268
PF01202 SKI Shikimate kinase 2.2E-32 865 1008
PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain 7.9E-23 1282 1362
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 1.3E-07 39 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C0S433|ARO1_PARBP Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02447 PE=3 SV=1 12 1542 0.0E+00
sp|C5JKE6|ARO1_AJEDS Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02999 PE=3 SV=1 12 1547 0.0E+00
sp|B6HAA7|ARO1_PENRW Pentafunctional AROM polypeptide OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=aroM PE=3 SV=1 7 1542 0.0E+00
sp|B8N4Q9|ARO1_ASPFN Pentafunctional AROM polypeptide OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aroM PE=3 SV=1 12 1547 0.0E+00
sp|Q2UCP6|ARO1_ASPOR Pentafunctional AROM polypeptide OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aroM PE=3 SV=1 12 1543 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C0S433|ARO1_PARBP Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02447 PE=3 SV=1 12 1542 0.0E+00
sp|C5JKE6|ARO1_AJEDS Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02999 PE=3 SV=1 12 1547 0.0E+00
sp|B6HAA7|ARO1_PENRW Pentafunctional AROM polypeptide OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=aroM PE=3 SV=1 7 1542 0.0E+00
sp|B8N4Q9|ARO1_ASPFN Pentafunctional AROM polypeptide OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aroM PE=3 SV=1 12 1547 0.0E+00
sp|Q2UCP6|ARO1_ASPOR Pentafunctional AROM polypeptide OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aroM PE=3 SV=1 12 1543 0.0E+00
sp|C5G8R4|ARO1_AJEDR Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_01028 PE=3 SV=1 12 1547 0.0E+00
sp|C1H8L1|ARO1_PARBA Pentafunctional AROM polypeptide OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_07102 PE=3 SV=2 12 1542 0.0E+00
sp|Q4WS76|ARO1_ASPFU Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aroM PE=3 SV=1 12 1543 0.0E+00
sp|B0XRM8|ARO1_ASPFC Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aroM PE=3 SV=1 12 1543 0.0E+00
sp|C0NL63|ARO1_AJECG Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_03893 PE=3 SV=1 12 1548 0.0E+00
sp|A1D244|ARO1_NEOFI Pentafunctional AROM polypeptide OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aroM PE=3 SV=1 12 1547 0.0E+00
sp|C6HCG7|ARO1_AJECH Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain H143) GN=HCDG_03716 PE=3 SV=1 12 1548 0.0E+00
sp|P07547|ARO1_EMENI Pentafunctional AROM polypeptide OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aromA PE=1 SV=3 7 1547 0.0E+00
sp|A1CP85|ARO1_ASPCL Pentafunctional AROM polypeptide OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aroM PE=3 SV=1 12 1542 0.0E+00
sp|C5FQ73|ARO1_ARTOC Pentafunctional AROM polypeptide OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04845 PE=3 SV=1 11 1547 0.0E+00
sp|C4JYG6|ARO1_UNCRE Pentafunctional AROM polypeptide OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07217 PE=3 SV=1 12 1547 0.0E+00
sp|B6QCA7|ARO12_TALMQ Pentafunctional AROM polypeptide 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-2 PE=3 SV=1 12 1547 0.0E+00
sp|B8M0U4|ARO1_TALSN Pentafunctional AROM polypeptide OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=aroM PE=3 SV=1 12 1547 0.0E+00
sp|B6QWH9|ARO11_TALMQ Pentafunctional AROM polypeptide 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-1 PE=3 SV=1 12 1547 0.0E+00
sp|Q0D0F3|ARO1_ASPTN Pentafunctional AROM polypeptide OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aroM PE=3 SV=1 12 1547 0.0E+00
sp|Q0V3H0|ARO1_PHANO Pentafunctional AROM polypeptide OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_01444 PE=3 SV=2 12 1547 0.0E+00
sp|Q9P7R0|ARO1_SCHPO Pentafunctional AROM polypeptide OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aro1 PE=3 SV=1 11 1547 0.0E+00
sp|B6JVD0|ARO1_SCHJY Pentafunctional AROM polypeptide OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=aro1 PE=3 SV=1 35 1547 0.0E+00
sp|Q6C1X5|ARO1_YARLI Pentafunctional AROM polypeptide OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARO1 PE=3 SV=1 10 1547 0.0E+00
sp|B9WFG1|ARO1_CANDC Pentafunctional AROM polypeptide OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ARO1 PE=3 SV=1 8 1547 0.0E+00
sp|C4R4R8|ARO1_PICPG Pentafunctional AROM polypeptide OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ARO1 PE=3 SV=1 10 1542 0.0E+00
sp|A5H2Q8|ARO11_LODEL Pentafunctional AROM polypeptide 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-1 PE=3 SV=1 8 1547 0.0E+00
sp|C5M1X2|ARO1_CANTT Pentafunctional AROM polypeptide OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=ARO1 PE=3 SV=1 8 1547 0.0E+00
sp|Q5AME2|ARO1_CANAL Pentafunctional AROM polypeptide OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARO1 PE=3 SV=1 8 1547 0.0E+00
sp|A5H2P4|ARO12_LODEL Pentafunctional AROM polypeptide 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-2 PE=3 SV=1 8 1547 0.0E+00
sp|C5DN02|ARO1_LACTC Pentafunctional AROM polypeptide OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ARO1 PE=3 SV=1 21 1547 0.0E+00
sp|A3LSZ2|ARO1_PICST Pentafunctional AROM polypeptide OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARO1 PE=3 SV=2 7 1547 0.0E+00
sp|C4Y9D5|ARO1_CLAL4 Pentafunctional AROM polypeptide OS=Clavispora lusitaniae (strain ATCC 42720) GN=ARO1 PE=3 SV=1 7 1547 0.0E+00
sp|C7GIN5|ARO1_YEAS2 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain JAY291) GN=ARO1 PE=3 SV=1 12 1547 0.0E+00
sp|C5DVG6|ARO1_ZYGRC Pentafunctional AROM polypeptide OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ARO1 PE=3 SV=1 10 1547 0.0E+00
sp|P08566|ARO1_YEAST Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO1 PE=1 SV=1 12 1547 0.0E+00
sp|A6ZY89|ARO1_YEAS7 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain YJM789) GN=ARO1 PE=3 SV=1 12 1547 0.0E+00
sp|C8Z543|ARO1_YEAS8 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ARO1 PE=3 SV=1 12 1547 0.0E+00
sp|B3LGE9|ARO1_YEAS1 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ARO1 PE=3 SV=1 12 1547 0.0E+00
sp|Q6CJC4|ARO1_KLULA Pentafunctional AROM polypeptide OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARO1 PE=3 SV=1 12 1547 0.0E+00
sp|Q74ZZ1|ARO1_ASHGO Pentafunctional AROM polypeptide OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARO1 PE=3 SV=2 10 1547 0.0E+00
sp|Q6FIV4|ARO1_CANGA Pentafunctional AROM polypeptide OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARO1 PE=3 SV=1 12 1542 0.0E+00
sp|B0D6H2|ARO1_LACBS Pentafunctional AROM polypeptide OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_233717 PE=3 SV=1 12 1547 0.0E+00
sp|Q8J294|ARO1_THACU Pentafunctional AROM polypeptide OS=Thanatephorus cucumeris PE=3 SV=1 12 1547 0.0E+00
sp|Q12659|ARO1_PNECA Pentafunctional AROM polypeptide OS=Pneumocystis carinii GN=arom PE=3 SV=1 12 1547 0.0E+00
sp|A8NMB4|ARO1_COPC7 Pentafunctional AROM polypeptide OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_09809 PE=3 SV=2 12 1547 0.0E+00
sp|P0CM22|ARO1_CRYNJ Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB01990 PE=3 SV=1 12 1542 0.0E+00
sp|P0CM23|ARO1_CRYNB Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB3730 PE=3 SV=1 12 1542 0.0E+00
sp|Q4P8F6|ARO1_USTMA Pentafunctional AROM polypeptide OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_03607 PE=3 SV=1 31 1542 0.0E+00
sp|A8QCB2|ARO1_MALGO Pentafunctional AROM polypeptide OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_3989 PE=3 SV=1 31 1547 0.0E+00
sp|A6R8Q8|ARO1_AJECN Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06699 PE=3 SV=1 12 893 0.0E+00
sp|C7YZ74|ARO1_NECH7 Pentafunctional AROM polypeptide OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_47780 PE=3 SV=1 1 1547 0.0E+00
sp|B2B223|ARO1_PODAN Pentafunctional AROM polypeptide OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_5280 PE=3 SV=1 1 1547 0.0E+00
sp|D1ZA70|ARO1_SORMK Pentafunctional AROM polypeptide OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_02366 PE=3 SV=1 7 1547 0.0E+00
sp|Q8X071|ARO1_NEUCR Pentafunctional AROM polypeptide OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-1 PE=3 SV=1 4 1547 0.0E+00
sp|C9SE96|ARO1_VERA1 Pentafunctional AROM polypeptide OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03429 PE=3 SV=1 12 1547 0.0E+00
sp|A4RD09|ARO1_MAGO7 Pentafunctional AROM polypeptide OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_01128 PE=3 SV=2 7 1547 0.0E+00
sp|A7F7H0|ARO1_SCLS1 Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13550 PE=3 SV=1 12 1548 0.0E+00
sp|Q5XNP0|ARO1_SCLSC Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum PE=3 SV=1 12 1543 0.0E+00
sp|C1FYJ9|ARO1_PARBD Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00875 PE=3 SV=2 12 1542 0.0E+00
sp|C5PA86|ARO1_COCP7 Pentafunctional AROM polypeptide OS=Coccidioides posadasii (strain C735) GN=CPC735_008210 PE=3 SV=1 11 1547 0.0E+00
sp|A6R8Q8|ARO1_AJECN Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06699 PE=3 SV=1 981 1548 3.0E-156
sp|B7VM38|AROA_VIBTL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=aroA PE=3 SV=1 406 828 1.0E-82
sp|B2VC79|AROA_ERWT9 3-phosphoshikimate 1-carboxyvinyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aroA PE=3 SV=1 405 830 7.0E-82
sp|A3QEC0|AROA_SHELP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aroA PE=3 SV=1 402 825 4.0E-81
sp|C3LN54|AROA_VIBCM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=aroA PE=3 SV=1 406 830 3.0E-80
sp|Q9KRB0|AROA_VIBCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroA PE=1 SV=1 406 830 3.0E-80
sp|A4TN18|AROA_YERPP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis (strain Pestoides F) GN=aroA PE=3 SV=1 405 834 4.0E-80
sp|Q1CGG5|AROA_YERPN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroA PE=3 SV=1 405 834 4.0E-80
sp|A9R7I2|AROA_YERPG 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroA PE=3 SV=1 405 834 4.0E-80
sp|Q60112|AROA_YERPE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis GN=aroA PE=3 SV=2 405 834 4.0E-80
sp|Q1CA73|AROA_YERPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroA PE=3 SV=1 405 834 4.0E-80
sp|B1JRD9|AROA_YERPY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroA PE=3 SV=1 405 834 1.0E-79
sp|Q66CI8|AROA_YERPS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroA PE=3 SV=1 405 834 1.0E-79
sp|B2KA23|AROA_YERPB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroA PE=3 SV=1 405 834 1.0E-79
sp|A7FJW9|AROA_YERP3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroA PE=3 SV=1 405 834 1.0E-79
sp|A6Q7Q0|AROA_SULNB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=aroA PE=3 SV=1 406 828 2.0E-79
sp|A5F7G5|AROA_VIBC3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aroA PE=3 SV=1 406 830 2.0E-79
sp|Q8RLV9|AROA_XENNA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6) GN=aroA PE=3 SV=1 405 835 4.0E-79
sp|Q7MJ45|AROA_VIBVY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio vulnificus (strain YJ016) GN=aroA PE=3 SV=1 400 829 5.0E-79
sp|C6DF65|AROA_PECCP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroA PE=3 SV=1 400 830 8.0E-79
sp|Q6D401|AROA_PECAS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aroA PE=3 SV=1 400 830 1.0E-78
sp|B6EIX8|AROA_ALISL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=aroA PE=3 SV=1 409 830 3.0E-78
sp|A8GCH1|AROA_SERP5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Serratia proteamaculans (strain 568) GN=aroA PE=3 SV=1 405 834 3.0E-78
sp|P19688|AROA_YERE8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aroA PE=3 SV=2 405 834 3.0E-78
sp|Q2NUA9|AROA_SODGM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Sodalis glossinidius (strain morsitans) GN=aroA PE=3 SV=1 405 829 4.0E-78
sp|Q6LPE1|AROA_PHOPR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Photobacterium profundum GN=aroA PE=3 SV=1 406 833 5.0E-78
sp|Q7N6D5|AROA_PHOLL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroA PE=3 SV=1 405 833 7.0E-78
sp|Q93ED4|AROA_YERRU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia ruckeri GN=aroA PE=3 SV=1 405 830 8.0E-78
sp|Q482G5|AROA_COLP3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroA PE=3 SV=1 409 830 1.0E-77
sp|B0TT43|AROA_SHEHH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aroA PE=3 SV=1 400 829 2.0E-77
sp|Q87QX9|AROA_VIBPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroA PE=3 SV=1 406 828 2.0E-77
sp|A8H4A4|AROA_SHEPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aroA PE=3 SV=1 400 829 4.0E-77
sp|B8CMH2|AROA_SHEPW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=aroA PE=3 SV=1 405 825 6.0E-77
sp|C4K4D4|AROA_HAMD5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aroA PE=3 SV=1 405 829 9.0E-77
sp|A8AIH5|AROA_CITK8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aroA PE=3 SV=1 405 830 1.0E-76
sp|A9MHX5|AROA_SALAR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aroA PE=3 SV=1 409 830 2.0E-76
sp|Q32E25|AROA_SHIDS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aroA PE=3 SV=1 405 830 2.0E-76
sp|Q04570|AROA_PASMU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pasteurella multocida (strain Pm70) GN=aroA PE=3 SV=2 409 828 2.0E-76
sp|B5XY87|AROA_KLEP3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Klebsiella pneumoniae (strain 342) GN=aroA PE=3 SV=1 405 830 9.0E-76
sp|Q3Z3L4|AROA_SHISS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella sonnei (strain Ss046) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|Q31YU3|AROA_SHIBS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B2TUH3|AROA_SHIB3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B6I8Y0|AROA_ECOSE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain SE11) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|P0A6D3|AROA_ECOLI 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain K12) GN=aroA PE=1 SV=1 405 833 1.0E-75
sp|B1X848|AROA_ECODH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|C4ZQ34|AROA_ECOBW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B7M836|AROA_ECO8A 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O8 (strain IAI1) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B5YT42|AROA_ECO5E 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|P0A6D4|AROA_ECO57 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O157:H7 GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B7LDA0|AROA_ECO55 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|A7ZJZ7|AROA_ECO24 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|Q9ZFF7|AROA_SHISO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella sonnei GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|Q1RDV0|AROA_ECOUT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|Q0TJE5|AROA_ECOL5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|A1A9I5|AROA_ECOK1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O1:K1 / APEC GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B7MS23|AROA_ECO81 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O81 (strain ED1a) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B7MHL7|AROA_ECO45 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aroA PE=3 SV=1 405 833 1.0E-75
sp|B1IW23|AROA_ECOLC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aroA PE=3 SV=1 405 833 2.0E-75
sp|Q8FJB6|AROA_ECOL6 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroA PE=3 SV=1 405 833 2.0E-75
sp|A7ZYL1|AROA_ECOHS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=aroA PE=3 SV=1 405 833 2.0E-75
sp|B7NAQ7|AROA_ECOLU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aroA PE=3 SV=1 405 833 2.0E-75
sp|B4TRT9|AROA_SALSV 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroA PE=3 SV=1 409 830 2.0E-75
sp|O87006|AROA_SHIDY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella dysenteriae GN=aroA PE=3 SV=1 405 833 2.0E-75
sp|Q83RY8|AROA_SHIFL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella flexneri GN=aroA PE=3 SV=1 405 833 2.0E-75
sp|Q0SX08|AROA_SHIF8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=aroA PE=3 SV=1 405 833 2.0E-75
sp|Q8VP65|AROA_PHODP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Photobacterium damsela subsp. piscicida GN=aroA PE=3 SV=1 406 830 3.0E-75
sp|P24497|AROA_KLEPN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Klebsiella pneumoniae GN=aroA PE=3 SV=1 405 830 4.0E-75
sp|B1LJV6|AROA_ECOSM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aroA PE=3 SV=1 405 833 4.0E-75
sp|B7NM67|AROA_ECO7I 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aroA PE=3 SV=1 405 833 4.0E-75
sp|P05466|AROA_ARATH 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Arabidopsis thaliana GN=At2g45300 PE=2 SV=3 409 830 5.0E-75
sp|A4W8S8|AROA_ENT38 3-phosphoshikimate 1-carboxyvinyltransferase OS=Enterobacter sp. (strain 638) GN=aroA PE=3 SV=1 405 830 5.0E-75
sp|P07637|AROA_SALTY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroA PE=3 SV=2 409 830 6.0E-75
sp|P19786|AROA_SALTI 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella typhi GN=aroA PE=3 SV=2 409 830 6.0E-75
sp|B4TD38|AROA_SALHS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella heidelberg (strain SL476) GN=aroA PE=3 SV=1 409 830 7.0E-75
sp|B5BBP9|AROA_SALPK 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroA PE=3 SV=1 409 830 8.0E-75
sp|Q5PGG5|AROA_SALPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroA PE=3 SV=1 409 830 8.0E-75
sp|C0PXU4|AROA_SALPC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|A9N7V6|AROA_SALPB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|Q57R23|AROA_SALCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|A7MES7|AROA_CROS8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroA PE=3 SV=1 405 830 1.0E-74
sp|B4T142|AROA_SALNS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella newport (strain SL254) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|B5F161|AROA_SALA4 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella agona (strain SL483) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|A6T701|AROA_KLEP7 3-phosphoshikimate 1-carboxyvinyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aroA PE=3 SV=1 405 830 1.0E-74
sp|A5UCH8|AROA_HAEIE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain PittEE) GN=aroA PE=3 SV=1 405 830 1.0E-74
sp|Q4QL19|AROA_HAEI8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=aroA PE=3 SV=1 405 830 1.0E-74
sp|P22299|AROA_SALGL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella gallinarum GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|B5R8J5|AROA_SALG2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|B5QYQ8|AROA_SALEP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|B5FQ51|AROA_SALDC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella dublin (strain CT_02021853) GN=aroA PE=3 SV=1 409 830 1.0E-74
sp|A5UJ35|AROA_HAEIG 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain PittGG) GN=aroA PE=3 SV=1 405 830 2.0E-74
sp|A4Y732|AROA_SHEPC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aroA PE=3 SV=1 406 829 2.0E-74
sp|Q0HIX1|AROA_SHESM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain MR-4) GN=aroA PE=3 SV=1 409 825 3.0E-74
sp|A1RJF8|AROA_SHESW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain W3-18-1) GN=aroA PE=3 SV=1 406 829 5.0E-74
sp|B7UMZ4|AROA_ECO27 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aroA PE=3 SV=1 405 833 5.0E-74
sp|B8EA95|AROA_SHEB2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS223) GN=aroA PE=3 SV=1 406 829 1.0E-73
sp|A1S6D3|AROA_SHEAM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aroA PE=3 SV=1 406 830 2.0E-73
sp|Q15T04|AROA_PSEA6 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroA PE=3 SV=1 405 830 2.0E-73
sp|A8FVN6|AROA_SHESH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=aroA PE=3 SV=1 405 829 3.0E-73
sp|B5FG60|AROA_VIBFM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio fischeri (strain MJ11) GN=aroA PE=3 SV=1 409 830 3.0E-73
sp|B1KF47|AROA_SHEWM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroA PE=3 SV=1 405 829 3.0E-73
sp|Q03421|AROA_HAEIN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroA PE=3 SV=2 405 830 4.0E-73
sp|Q5E3Z0|AROA_VIBF1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=aroA PE=3 SV=1 409 830 4.0E-73
sp|A7N1K3|AROA_VIBCB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroA PE=3 SV=1 406 828 4.0E-73
sp|A6VXX9|AROA_MARMS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Marinomonas sp. (strain MWYL1) GN=aroA PE=3 SV=1 409 829 5.0E-73
sp|Q3MAV9|AROA_ANAVT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroA PE=3 SV=1 396 825 5.0E-73
sp|Q65S78|AROA_MANSM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroA PE=3 SV=1 405 829 6.0E-73
sp|A3D4A6|AROA_SHEB5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroA PE=3 SV=1 406 829 6.0E-73
sp|Q7VR41|AROA_BLOFL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Blochmannia floridanus GN=aroA PE=3 SV=1 400 826 6.0E-73
sp|Q8EEH8|AROA_SHEON 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella oneidensis (strain MR-1) GN=aroA PE=3 SV=1 409 825 7.0E-73
sp|Q081U4|AROA_SHEFN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroA PE=3 SV=1 409 830 8.0E-73
sp|Q0HV11|AROA_SHESR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain MR-7) GN=aroA PE=3 SV=1 409 825 8.0E-73
sp|A0KWN7|AROA_SHESA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain ANA-3) GN=aroA PE=3 SV=1 409 825 1.0E-72
sp|Q8YMB5|AROA_NOSS1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroA PE=3 SV=1 396 825 3.0E-72
sp|A6VMU5|AROA_ACTSZ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroA PE=3 SV=1 405 833 6.0E-72
sp|A9L2X7|AROA_SHEB9 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS195) GN=aroA PE=3 SV=1 406 829 7.0E-72
sp|Q492S6|AROA_BLOPB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=aroA PE=3 SV=1 400 829 1.0E-71
sp|A6WNN0|AROA_SHEB8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS185) GN=aroA PE=3 SV=1 406 829 1.0E-71
sp|Q0I320|AROA_HAES1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus somnus (strain 129Pt) GN=aroA PE=3 SV=1 406 830 1.0E-71
sp|B8D7K3|AROA_BUCAT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=aroA PE=3 SV=1 405 831 2.0E-71
sp|Q12NE1|AROA_SHEDO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aroA PE=3 SV=1 406 825 2.0E-71
sp|P57396|AROA_BUCAI 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aroA PE=3 SV=1 405 831 2.0E-71
sp|B8D9A1|AROA_BUCA5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=aroA PE=3 SV=1 405 831 2.0E-71
sp|Q7VLN9|AROA_HAEDU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroA PE=3 SV=1 406 825 3.0E-71
sp|B4ET25|AROA_PROMH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Proteus mirabilis (strain HI4320) GN=aroA PE=3 SV=1 405 829 3.0E-71
sp|P54220|AROA_MANHA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Mannheimia haemolytica GN=aroA PE=3 SV=2 409 830 3.0E-71
sp|B0UT47|AROA_HISS2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Histophilus somni (strain 2336) GN=aroA PE=3 SV=1 406 830 4.0E-71
sp|P59416|AROA_BUCBP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aroA PE=3 SV=1 405 828 5.0E-71
sp|A3N063|AROA_ACTP2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroA PE=3 SV=1 409 830 8.0E-71
sp|B5YHI4|AROB_THEYD 3-dehydroquinate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=aroB PE=3 SV=1 15 370 2.0E-70
sp|P52310|AROA_HISSO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Histophilus somni GN=aroA PE=3 SV=1 406 830 2.0E-70
sp|B0BNY1|AROA_ACTPJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=aroA PE=3 SV=1 409 830 3.0E-70
sp|B3GXD4|AROA_ACTP7 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroA PE=3 SV=1 409 830 3.0E-70
sp|B0K924|AROB_THEP3 3-dehydroquinate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=aroB PE=3 SV=1 31 388 1.0E-69
sp|Q8Y0Y6|AROA_RALSO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=aroA PE=3 SV=1 400 825 2.0E-69
sp|P17688|AROA_BRANA 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Brassica napus PE=3 SV=1 370 828 2.0E-69
sp|B2U886|AROA_RALPJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Ralstonia pickettii (strain 12J) GN=aroA PE=3 SV=1 405 825 2.0E-69
sp|Q9JYU1|AROA_NEIMB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroA PE=3 SV=1 405 829 3.0E-69
sp|Q3IJA2|AROB_PSEHT 3-dehydroquinate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroB PE=3 SV=1 17 388 3.0E-69
sp|A1STZ0|AROA_PSYIN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Psychromonas ingrahamii (strain 37) GN=aroA PE=3 SV=1 406 829 5.0E-69
sp|Q8RB14|AROB_CALS4 3-dehydroquinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=aroB PE=3 SV=1 31 370 6.0E-69
sp|Q1LTL1|AROA_BAUCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=aroA PE=3 SV=1 405 828 6.0E-69
sp|A1KUN6|AROA_NEIMF 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroA PE=3 SV=1 405 835 7.0E-69
sp|C1D543|AROA_LARHH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=aroA PE=3 SV=1 402 830 7.0E-69
sp|A4J3A3|AROB_DESRM 3-dehydroquinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=aroB PE=3 SV=1 31 381 8.0E-69
sp|B2JF04|AROA_BURP8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=aroA PE=3 SV=1 405 826 9.0E-69
sp|Q82TD4|AROA_NITEU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroA PE=3 SV=1 409 829 1.0E-68
sp|B0K0I7|AROB_THEPX 3-dehydroquinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=aroB PE=3 SV=1 31 388 2.0E-68
sp|A3Q9D8|AROB_SHELP 3-dehydroquinate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aroB PE=3 SV=1 27 372 2.0E-68
sp|Q0KDH9|AROA_CUPNH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroA PE=3 SV=1 405 829 2.0E-68
sp|P23981|AROA1_TOBAC 3-phosphoshikimate 1-carboxyvinyltransferase 1, chloroplastic OS=Nicotiana tabacum GN=EPSPS-1 PE=2 SV=1 400 830 3.0E-68
sp|Q9JTT3|AROA_NEIMA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroA PE=3 SV=1 405 829 4.0E-68
sp|B7K660|AROB_CYAP8 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 8801) GN=aroB PE=3 SV=1 51 370 5.0E-68
sp|Q9X4H2|AROA_EDWI9 3-phosphoshikimate 1-carboxyvinyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=aroA PE=3 SV=1 409 829 5.0E-68
sp|Q46Y50|AROA_CUPPJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroA PE=3 SV=1 405 825 6.0E-68
sp|B1YV33|AROA_BURA4 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=aroA PE=3 SV=1 405 829 8.0E-68
sp|Q0BH93|AROA_BURCM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroA PE=3 SV=1 405 829 8.0E-68
sp|A9ADV6|AROA_BURM1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroA PE=3 SV=1 405 829 1.0E-67
sp|Q13VC2|AROA_BURXL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia xenovorans (strain LB400) GN=aroA PE=3 SV=1 405 826 1.0E-67
sp|P73997|AROB_SYNY3 3-dehydroquinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aroB PE=3 SV=1 5 388 2.0E-67
sp|P11043|AROA_PETHY 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Petunia hybrida PE=1 SV=1 400 830 2.0E-67
sp|B3R368|AROA_CUPTR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aroA PE=3 SV=1 405 829 3.0E-67
sp|Q0AIZ5|AROA_NITEC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nitrosomonas eutropha (strain C91) GN=aroA PE=3 SV=1 409 829 4.0E-67
sp|Q63Q57|AROB_BURPS 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain K96243) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|A3NED2|AROB_BURP6 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 668) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|Q3JMW1|AROB_BURP1 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|A3P066|AROB_BURP0 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|A1V8D7|AROB_BURMS 3-dehydroquinate synthase OS=Burkholderia mallei (strain SAVP1) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|Q62GB0|AROB_BURMA 3-dehydroquinate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|A2S718|AROB_BURM9 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|A3MPY1|AROB_BURM7 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=aroB PE=3 SV=1 27 371 4.0E-67
sp|B2T630|AROA_BURPP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=aroA PE=3 SV=1 405 833 1.0E-66
sp|Q3SK83|AROA_THIDA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=aroA PE=3 SV=1 405 830 1.0E-66
sp|B4EB42|AROA_BURCJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroA PE=3 SV=1 405 829 1.0E-66
sp|B5EP40|AROB_ACIF5 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aroB PE=3 SV=1 27 369 2.0E-66
sp|B7J629|AROB_ACIF2 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aroB PE=3 SV=1 27 369 2.0E-66
sp|A4JCH4|AROA_BURVG 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroA PE=3 SV=1 405 829 2.0E-66
sp|Q088S6|AROB_SHEFN 3-dehydroquinate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroB PE=3 SV=1 27 370 3.0E-66
sp|P10748|AROA_SOLLC 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 400 830 3.0E-66
sp|Q5F889|AROA_NEIG1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroA PE=3 SV=1 388 829 5.0E-66
sp|B1JXR9|AROA_BURCC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroA PE=3 SV=1 405 829 5.0E-66
sp|A1SB13|AROB_SHEAM 3-dehydroquinate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aroB PE=3 SV=1 27 381 7.0E-66
sp|B4RL93|AROA_NEIG2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroA PE=3 SV=1 405 829 8.0E-66
sp|Q39IG1|AROA_BURL3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroA PE=3 SV=1 405 829 8.0E-66
sp|Q65R35|AROB_MANSM 3-dehydroquinate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroB PE=3 SV=1 15 386 9.0E-66
sp|Q0HDV7|AROB_SHESM 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-4) GN=aroB PE=3 SV=1 27 370 9.0E-66
sp|Q0BJ01|AROB_BURCM 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroB PE=3 SV=1 27 371 9.0E-66
sp|Q057N6|AROA_BUCCC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=aroA PE=3 SV=1 409 825 1.0E-65
sp|C4LEG3|AROA_TOLAT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroA PE=3 SV=1 405 833 1.0E-65
sp|Q1BY28|AROA_BURCA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroA PE=3 SV=1 405 829 1.0E-65
sp|B3H035|AROB_ACTP7 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroB PE=3 SV=1 27 390 1.0E-65
sp|A3MYR5|AROB_ACTP2 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroB PE=3 SV=1 27 390 1.0E-65
sp|Q7VNR5|AROB_HAEDU 3-dehydroquinate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroB PE=3 SV=1 17 372 1.0E-65
sp|B0JID6|AROB_MICAN 3-dehydroquinate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=aroB PE=3 SV=1 74 370 2.0E-65
sp|Q0I052|AROB_SHESR 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-7) GN=aroB PE=3 SV=1 27 370 2.0E-65
sp|A4SM13|AROA_AERS4 3-phosphoshikimate 1-carboxyvinyltransferase OS=Aeromonas salmonicida (strain A449) GN=aroA PE=3 SV=1 406 833 2.0E-65
sp|B1YRS4|AROB_BURA4 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=aroB PE=3 SV=1 27 371 2.0E-65
sp|A0K5M1|AROA_BURCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=aroA PE=3 SV=1 405 829 2.0E-65
sp|B0TL76|AROB_SHEHH 3-dehydroquinate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aroB PE=3 SV=1 27 370 2.0E-65
sp|Q3M4V2|AROB_ANAVT 3-dehydroquinate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroB PE=3 SV=1 31 369 2.0E-65
sp|A1RPQ6|AROB_SHESW 3-dehydroquinate synthase OS=Shewanella sp. (strain W3-18-1) GN=aroB PE=3 SV=1 27 370 2.0E-65
sp|A6WTR1|AROB_SHEB8 3-dehydroquinate synthase OS=Shewanella baltica (strain OS185) GN=aroB PE=3 SV=1 27 370 2.0E-65
sp|B8EBF1|AROB_SHEB2 3-dehydroquinate synthase OS=Shewanella baltica (strain OS223) GN=aroB PE=3 SV=1 27 370 2.0E-65
sp|Q489N3|AROB_COLP3 3-dehydroquinate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroB PE=3 SV=1 79 372 3.0E-65
sp|A9L694|AROB_SHEB9 3-dehydroquinate synthase OS=Shewanella baltica (strain OS195) GN=aroB PE=3 SV=1 27 370 3.0E-65
sp|B1JU67|AROB_BURCC 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroB PE=3 SV=1 27 371 3.0E-65
sp|Q82TB9|AROB_NITEU 3-dehydroquinate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroB PE=3 SV=1 35 370 4.0E-65
sp|A8GZ30|AROB_SHEPA 3-dehydroquinate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aroB PE=3 SV=1 27 391 4.0E-65
sp|Q8EK19|AROB_SHEON 3-dehydroquinate synthase OS=Shewanella oneidensis (strain MR-1) GN=aroB PE=3 SV=1 27 372 5.0E-65
sp|B4E603|AROB_BURCJ 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroB PE=3 SV=1 27 371 5.0E-65
sp|B3PJM0|AROA_CELJU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=aroA PE=3 SV=1 409 830 5.0E-65
sp|A0K3S0|AROB_BURCH 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=aroB PE=3 SV=1 27 371 5.0E-65
sp|Q1BRZ3|AROB_BURCA 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroB PE=3 SV=1 27 371 5.0E-65
sp|A4YBT0|AROB_SHEPC 3-dehydroquinate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aroB PE=3 SV=1 27 370 6.0E-65
sp|A4JAT5|AROB_BURVG 3-dehydroquinate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroB PE=3 SV=1 27 391 6.0E-65
sp|Q3ILA2|AROA_PSEHT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroA PE=3 SV=1 405 829 8.0E-65
sp|A0L242|AROB_SHESA 3-dehydroquinate synthase OS=Shewanella sp. (strain ANA-3) GN=aroB PE=3 SV=1 27 370 8.0E-65
sp|Q2FQ54|AROA_METHJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=aroA PE=3 SV=1 405 833 2.0E-64
sp|Q46WJ4|AROB_CUPPJ 3-dehydroquinate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroB PE=3 SV=1 27 396 2.0E-64
sp|Q39KC4|AROB_BURL3 3-dehydroquinate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroB PE=3 SV=1 42 371 2.0E-64
sp|A3DA14|AROB_SHEB5 3-dehydroquinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroB PE=3 SV=1 27 370 2.0E-64
sp|Q5N3D4|AROB_SYNP6 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=aroB PE=3 SV=1 79 388 2.0E-64
sp|Q3SLY4|AROB_THIDA 3-dehydroquinate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=aroB PE=3 SV=1 45 370 2.0E-64
sp|C4LB07|AROB_TOLAT 3-dehydroquinate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroB PE=3 SV=1 27 370 2.0E-64
sp|A8G195|AROB_SHESH 3-dehydroquinate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=aroB PE=3 SV=1 32 370 2.0E-64
sp|B1KP72|AROB_SHEWM 3-dehydroquinate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroB PE=3 SV=1 79 388 2.0E-64
sp|A9ADP0|AROB_BURM1 3-dehydroquinate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroB PE=3 SV=1 76 371 3.0E-64
sp|B8CNI9|AROB_SHEPW 3-dehydroquinate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=aroB PE=3 SV=1 8 388 3.0E-64
sp|A3DDJ2|AROB_CLOTH 3-dehydroquinate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=aroB PE=3 SV=1 27 364 3.0E-64
sp|B1WUD4|AROB_CYAA5 3-dehydroquinate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=aroB PE=3 SV=1 73 372 3.0E-64
sp|Q9KNV2|AROB_VIBCH 3-dehydroquinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroB PE=1 SV=2 27 385 4.0E-64
sp|Q9L213|AROA2_STRCO 3-phosphoshikimate 1-carboxyvinyltransferase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=aroA2 PE=3 SV=1 401 828 4.0E-64
sp|B2IYE4|AROA_NOSP7 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroA PE=3 SV=1 396 833 4.0E-64
sp|B2UEG9|AROB_RALPJ 3-dehydroquinate synthase OS=Ralstonia pickettii (strain 12J) GN=aroB PE=3 SV=1 27 396 5.0E-64
sp|B1XKA0|AROB_SYNP2 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=aroB PE=3 SV=1 31 381 5.0E-64
sp|Q8YVQ0|AROB_NOSS1 3-dehydroquinate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroB PE=3 SV=1 45 369 7.0E-64
sp|A4G861|AROA_HERAR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Herminiimonas arsenicoxydans GN=aroA PE=3 SV=2 409 836 9.0E-64
sp|Q15Y44|AROB_PSEA6 3-dehydroquinate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroB PE=3 SV=1 13 384 1.0E-63
sp|Q4FQI3|AROB_PSYA2 3-dehydroquinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aroB PE=3 SV=1 79 370 1.0E-63
sp|B2J913|AROB_NOSP7 3-dehydroquinate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroB PE=3 SV=1 79 369 2.0E-63
sp|B0UTE6|AROB_HISS2 3-dehydroquinate synthase OS=Histophilus somni (strain 2336) GN=aroB PE=3 SV=1 27 374 2.0E-63
sp|Q0I432|AROB_HAES1 3-dehydroquinate synthase OS=Haemophilus somnus (strain 129Pt) GN=aroB PE=3 SV=1 27 374 3.0E-63
sp|Q7VT93|AROB_BORPE 3-dehydroquinate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=aroB PE=3 SV=1 72 370 4.0E-63
sp|Q7W2B6|AROB_BORPA 3-dehydroquinate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aroB PE=3 SV=1 72 370 4.0E-63
sp|Q7WR84|AROB_BORBR 3-dehydroquinate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aroB PE=3 SV=1 72 370 4.0E-63
sp|Q5QZ50|AROA_IDILO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroA PE=3 SV=1 405 830 4.0E-63
sp|Q2YB61|AROB_NITMU 3-dehydroquinate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=aroB PE=3 SV=1 46 370 6.0E-63
sp|Q59178|AROA_BUCAP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroA PE=3 SV=2 405 828 6.0E-63
sp|A5ETC5|AROB_BRASB 3-dehydroquinate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aroB PE=3 SV=1 40 375 6.0E-63
sp|B7VLJ6|AROB_VIBTL 3-dehydroquinate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=aroB PE=3 SV=1 27 369 8.0E-63
sp|A3CV28|AROA_METMJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=aroA PE=3 SV=1 409 828 9.0E-63
sp|B3R7B8|AROB_CUPTR 3-dehydroquinate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aroB PE=3 SV=1 27 396 1.0E-62
sp|B7KJH2|AROB_CYAP7 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7424) GN=aroB PE=3 SV=1 76 369 1.0E-62
sp|Q8XV62|AROB_RALSO 3-dehydroquinate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=aroB PE=3 SV=1 27 396 1.0E-62
sp|Q74BL6|AROB_GEOSL 3-dehydroquinate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=aroB PE=3 SV=1 74 326 1.0E-62
sp|B5E8I9|AROB_GEOBB 3-dehydroquinate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=aroB PE=3 SV=1 41 326 2.0E-62
sp|Q1Q8Q9|AROB_PSYCK 3-dehydroquinate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=aroB PE=3 SV=1 45 370 2.0E-62
sp|Q39X04|AROB_GEOMG 3-dehydroquinate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=aroB PE=3 SV=1 46 326 2.0E-62
sp|Q0K669|AROB_CUPNH 3-dehydroquinate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroB PE=3 SV=1 76 396 2.0E-62
sp|Q0AJ12|AROB_NITEC 3-dehydroquinate synthase OS=Nitrosomonas eutropha (strain C91) GN=aroB PE=3 SV=1 35 370 3.0E-62
sp|C6E0S2|AROB_GEOSM 3-dehydroquinate synthase OS=Geobacter sp. (strain M21) GN=aroB PE=3 SV=1 41 326 4.0E-62
sp|A5EXS0|AROB_DICNV 3-dehydroquinate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=aroB PE=3 SV=1 27 393 4.0E-62
sp|A1B1J4|AROB_PARDP 3-dehydroquinate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=aroB PE=3 SV=1 46 371 6.0E-62
sp|Q8DCM0|AROB_VIBVU 3-dehydroquinate synthase OS=Vibrio vulnificus (strain CMCP6) GN=aroB PE=3 SV=1 27 369 6.0E-62
sp|A4XPQ2|AROB_PSEMY 3-dehydroquinate synthase OS=Pseudomonas mendocina (strain ymp) GN=aroB PE=3 SV=1 27 370 6.0E-62
sp|A7MSY2|AROB_VIBCB 3-dehydroquinate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroB PE=3 SV=1 28 369 7.0E-62
sp|Q7MH84|AROB_VIBVY 3-dehydroquinate synthase OS=Vibrio vulnificus (strain YJ016) GN=aroB PE=3 SV=1 27 369 7.0E-62
sp|Q21BX8|AROB_RHOPB 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=aroB PE=3 SV=1 31 381 1.0E-61
sp|A6VKZ5|AROB_ACTSZ 3-dehydroquinate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroB PE=3 SV=1 27 374 1.0E-61
sp|A1AQL5|AROB_PELPD 3-dehydroquinate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=aroB PE=3 SV=1 15 323 1.0E-61
sp|A0LLU6|AROA_SYNFM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=aroA PE=3 SV=1 401 830 1.0E-61
sp|P57924|AROB_PASMU 3-dehydroquinate synthase OS=Pasteurella multocida (strain Pm70) GN=aroB PE=3 SV=1 27 374 1.0E-61
sp|B0CBS9|AROB_ACAM1 3-dehydroquinate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=aroB PE=3 SV=1 77 370 2.0E-61
sp|B3QAH7|AROB_RHOPT 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=aroB PE=3 SV=1 31 370 2.0E-61
sp|B8GF70|AROA_METPE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=aroA PE=3 SV=1 407 829 4.0E-61
sp|Q83AJ2|AROB_COXBU 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aroB PE=3 SV=1 19 390 5.0E-61
sp|A9NB81|AROB_COXBR 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=aroB PE=3 SV=1 19 390 5.0E-61
sp|C5BGQ4|AROB_EDWI9 3-dehydroquinate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=aroB PE=3 SV=1 45 381 5.0E-61
sp|Q6NCG9|AROB_RHOPA 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=aroB PE=3 SV=1 31 370 5.0E-61
sp|Q9A434|AROB_CAUCR 3-dehydroquinate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=aroB PE=3 SV=1 79 375 6.0E-61
sp|B8H332|AROB_CAUCN 3-dehydroquinate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=aroB PE=3 SV=1 79 375 6.0E-61
sp|B6J4A4|AROB_COXB1 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=aroB PE=3 SV=1 19 390 6.0E-61
sp|A8GKQ7|AROB_SERP5 3-dehydroquinate synthase OS=Serratia proteamaculans (strain 568) GN=aroB PE=3 SV=1 45 370 7.0E-61
sp|Q87L68|AROB_VIBPA 3-dehydroquinate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroB PE=3 SV=1 28 387 9.0E-61
sp|A1SRB7|AROB_PSYIN 3-dehydroquinate synthase OS=Psychromonas ingrahamii (strain 37) GN=aroB PE=3 SV=1 79 370 9.0E-61
sp|Q1LI88|AROB_CUPMC 3-dehydroquinate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=aroB PE=3 SV=1 27 396 1.0E-60
sp|B5ZS37|AROA_RHILW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aroA PE=3 SV=1 394 829 1.0E-60
sp|Q89XW8|AROB_BRADU 3-dehydroquinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aroB PE=3 SV=1 40 375 1.0E-60
sp|B6J3I1|AROB_COXB2 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=aroB PE=3 SV=1 19 390 1.0E-60
sp|Q2RMW0|AROB_RHORT 3-dehydroquinate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=aroB PE=3 SV=1 79 379 2.0E-60
sp|A4WSQ8|AROB_RHOS5 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=aroB PE=3 SV=1 46 375 2.0E-60
sp|Q5P5P3|AROB_AROAE 3-dehydroquinate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=aroB PE=3 SV=1 73 385 3.0E-60
sp|Q8DKS3|AROB_THEEB 3-dehydroquinate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=aroB PE=3 SV=2 39 370 6.0E-60
sp|Q48N21|AROA_PSE14 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aroA PE=3 SV=1 390 829 8.0E-60
sp|B0VQ34|AROB_ACIBS 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain SDF) GN=aroB PE=3 SV=1 27 370 8.0E-60
sp|B4RG33|AROB_PHEZH 3-dehydroquinate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=aroB PE=3 SV=1 79 391 8.0E-60
sp|B4TY46|AROB_SALSV 3-dehydroquinate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroB PE=3 SV=1 45 381 9.0E-60
sp|Q8U9V0|AROB_AGRFC 3-dehydroquinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aroB PE=3 SV=1 46 389 1.0E-59
sp|A6T1G3|AROA_JANMA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=aroA PE=3 SV=1 409 836 1.0E-59
sp|B0V8M9|AROB_ACIBY 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AYE) GN=aroB PE=3 SV=1 27 370 1.0E-59
sp|B7IAV6|AROB_ACIB5 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB0057) GN=aroB PE=3 SV=1 27 370 1.0E-59
sp|B7GVP5|AROB_ACIB3 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=aroB PE=3 SV=1 27 370 1.0E-59
sp|A3M9I8|AROB_ACIBT 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=aroB PE=3 SV=2 27 370 1.0E-59
sp|Q9RND7|AROA_BORBR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aroA PE=3 SV=2 406 829 1.0E-59
sp|A9KBB1|AROB_COXBN 3-dehydroquinate synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=aroB PE=3 SV=1 19 390 1.0E-59
sp|P77980|AROB_SALTY 3-dehydroquinate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroB PE=3 SV=1 45 381 1.0E-59
sp|A3PJS2|AROB_RHOS1 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=aroB PE=3 SV=1 46 374 2.0E-59
sp|B5BH29|AROB_SALPK 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|C0Q0G1|AROB_SALPC 3-dehydroquinate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|A9MT55|AROB_SALPB 3-dehydroquinate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|Q5PLX2|AROB_SALPA 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|B4SVI8|AROB_SALNS 3-dehydroquinate synthase OS=Salmonella newport (strain SL254) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|B4TKR2|AROB_SALHS 3-dehydroquinate synthase OS=Salmonella heidelberg (strain SL476) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|B5FJQ9|AROB_SALDC 3-dehydroquinate synthase OS=Salmonella dublin (strain CT_02021853) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|Q57IY8|AROB_SALCH 3-dehydroquinate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|B5F8K0|AROB_SALA4 3-dehydroquinate synthase OS=Salmonella agona (strain SL483) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|Q7W602|AROA_BORPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aroA PE=3 SV=1 406 829 2.0E-59
sp|B5R7M8|AROB_SALG2 3-dehydroquinate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|B5R2D5|AROB_SALEP 3-dehydroquinate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroB PE=3 SV=1 45 381 2.0E-59
sp|Q4ZY26|AROA_PSEU2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aroA PE=3 SV=1 390 829 2.0E-59
sp|B2I0J2|AROB_ACIBC 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ACICU) GN=aroB PE=3 SV=1 27 370 2.0E-59
sp|Q3J2J0|AROB_RHOS4 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=aroB PE=3 SV=1 46 374 2.0E-59
sp|B7N1G6|AROB_ECO81 3-dehydroquinate synthase OS=Escherichia coli O81 (strain ED1a) GN=aroB PE=3 SV=1 27 381 3.0E-59
sp|Q9K9D5|AROA2_BACHD 3-phosphoshikimate 1-carboxyvinyltransferase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aroA2 PE=3 SV=1 405 830 3.0E-59
sp|C5BRJ7|AROB_TERTT 3-dehydroquinate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=aroB PE=3 SV=1 27 370 4.0E-59
sp|A6TL07|AROB_ALKMQ 3-dehydroquinate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=aroB PE=3 SV=1 45 373 4.0E-59
sp|Q21H84|AROB_SACD2 3-dehydroquinate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aroB PE=3 SV=1 27 363 5.0E-59
sp|B8HRK7|AROB_CYAP4 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=aroB PE=3 SV=1 76 382 5.0E-59
sp|Q07VC9|AROB_RHOP5 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=aroB PE=3 SV=1 29 370 6.0E-59
sp|Q8Z205|AROB_SALTI 3-dehydroquinate synthase OS=Salmonella typhi GN=aroB PE=3 SV=1 45 381 6.0E-59
sp|B9KSJ9|AROB_RHOSK 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=aroB PE=3 SV=1 46 374 7.0E-59
sp|P12421|AROA_BORPE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=aroA PE=3 SV=2 406 829 8.0E-59
sp|C1F548|AROB_ACIC5 3-dehydroquinate synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=aroB PE=3 SV=1 27 389 8.0E-59
sp|C6DGD4|AROB_PECCP 3-dehydroquinate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroB PE=3 SV=1 45 381 2.0E-58
sp|Q6F7E5|AROB_ACIAD 3-dehydroquinate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aroB PE=3 SV=1 27 354 2.0E-58
sp|Q5QV59|AROB_IDILO 3-dehydroquinate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroB PE=3 SV=1 15 370 2.0E-58
sp|Q31BK2|AROB_PROM9 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=aroB PE=3 SV=1 50 369 2.0E-58
sp|B5YE18|AROB_DICT6 3-dehydroquinate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=aroB PE=3 SV=1 27 370 2.0E-58
sp|Q2NH05|AROA_METST 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aroA PE=3 SV=1 406 828 3.0E-58
sp|Q47JK6|AROB_DECAR 3-dehydroquinate synthase OS=Dechloromonas aromatica (strain RCB) GN=aroB PE=3 SV=1 27 380 3.0E-58
sp|Q4QNY2|AROB_HAEI8 3-dehydroquinate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=aroB PE=3 SV=1 27 375 4.0E-58
sp|A8G451|AROB_PROM2 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=aroB PE=3 SV=1 50 369 4.0E-58
sp|Q7NHM2|AROB_GLOVI 3-dehydroquinate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=aroB PE=3 SV=1 79 372 5.0E-58
sp|Q7NA56|AROB_PHOLL 3-dehydroquinate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroB PE=3 SV=1 45 370 5.0E-58
sp|A2BQG2|AROB_PROMS 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain AS9601) GN=aroB PE=3 SV=1 50 369 6.0E-58
sp|P43879|AROB_HAEIN 3-dehydroquinate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroB PE=3 SV=1 27 375 6.0E-58
sp|B2VJW7|AROB_ERWT9 3-dehydroquinate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aroB PE=3 SV=1 45 370 7.0E-58
sp|B3PRH7|AROA_RHIE6 3-phosphoshikimate 1-carboxyvinyltransferase OS=Rhizobium etli (strain CIAT 652) GN=aroA PE=3 SV=1 394 840 7.0E-58
sp|A5UG10|AROB_HAEIG 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittGG) GN=aroB PE=3 SV=1 79 378 7.0E-58
sp|Q87V15|AROB_PSESM 3-dehydroquinate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aroB PE=3 SV=1 46 370 8.0E-58
sp|A5GF05|AROB_GEOUR 3-dehydroquinate synthase OS=Geobacter uraniireducens (strain Rf4) GN=aroB PE=3 SV=1 46 303 8.0E-58
sp|A5UAU8|AROB_HAEIE 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittEE) GN=aroB PE=3 SV=1 27 378 8.0E-58
sp|Q31DP9|AROB_THICR 3-dehydroquinate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=aroB PE=3 SV=1 27 372 9.0E-58
sp|Q60BY2|AROB_METCA 3-dehydroquinate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aroB PE=3 SV=1 27 370 9.0E-58
sp|Q9PDP5|AROB_XYLFA 3-dehydroquinate synthase OS=Xylella fastidiosa (strain 9a5c) GN=aroB PE=3 SV=1 77 412 1.0E-57
sp|A4VH14|AROB_PSEU5 3-dehydroquinate synthase OS=Pseudomonas stutzeri (strain A1501) GN=aroB PE=3 SV=1 79 370 1.0E-57
sp|Q2KBU1|AROA_RHIEC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=aroA PE=3 SV=1 394 829 1.0E-57
sp|B0T8F3|AROB_CAUSK 3-dehydroquinate synthase OS=Caulobacter sp. (strain K31) GN=aroB PE=3 SV=1 79 394 1.0E-57
sp|Q3ZZN1|AROB_DEHMC 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=aroB PE=3 SV=1 27 370 1.0E-57
sp|Q8DUW2|AROB_STRMU 3-dehydroquinate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=aroB PE=3 SV=1 46 370 2.0E-57
sp|A6Q3Y3|AROB_NITSB 3-dehydroquinate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=aroB PE=3 SV=1 41 369 2.0E-57
sp|A0Q706|AROB_FRATN 3-dehydroquinate synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=aroB PE=3 SV=1 19 377 2.0E-57
sp|Q2A418|AROB_FRATH 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=aroB PE=3 SV=1 19 377 2.0E-57
sp|A7NBH0|AROB_FRATF 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=aroB PE=3 SV=1 19 377 2.0E-57
sp|A6UCL4|AROB_SINMW 3-dehydroquinate synthase OS=Sinorhizobium medicae (strain WSM419) GN=aroB PE=3 SV=1 46 371 2.0E-57
sp|Q5NFS1|AROB_FRATT 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=aroB PE=3 SV=1 19 377 2.0E-57
sp|Q14H73|AROB_FRAT1 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=aroB PE=3 SV=1 19 377 2.0E-57
sp|Q2L2S7|AROA_BORA1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella avium (strain 197N) GN=aroA PE=3 SV=1 409 829 3.0E-57
sp|A3PC83|AROB_PROM0 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=aroB PE=3 SV=1 50 369 3.0E-57
sp|Q48PH0|AROB_PSE14 3-dehydroquinate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aroB PE=3 SV=1 27 370 3.0E-57
sp|B2SGC9|AROB_FRATM 3-dehydroquinate synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=aroB PE=3 SV=1 19 377 3.0E-57
sp|C1D4Z4|AROB_LARHH 3-dehydroquinate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=aroB PE=3 SV=1 38 392 3.0E-57
sp|Q888I3|AROA_PSESM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aroA PE=3 SV=1 390 829 4.0E-57
sp|A5FRZ7|AROB_DEHMB 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=aroB PE=3 SV=1 27 370 5.0E-57
sp|A6Q908|AROB_SULNB 3-dehydroquinate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=aroB PE=3 SV=1 73 369 6.0E-57
sp|Q7VBT3|AROB_PROMA 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=aroB PE=3 SV=1 31 390 6.0E-57
sp|C3KAI3|AROB_PSEFS 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=aroB PE=3 SV=1 63 370 6.0E-57
sp|Q1GGQ1|AROB_RUEST 3-dehydroquinate synthase OS=Ruegeria sp. (strain TM1040) GN=aroB PE=3 SV=1 35 369 7.0E-57
sp|B8GPV3|AROB_THISH 3-dehydroquinate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=aroB PE=3 SV=1 73 370 9.0E-57
sp|Q6CZQ9|AROB_PECAS 3-dehydroquinate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aroB PE=3 SV=1 45 381 9.0E-57
sp|Q5KXU5|AROB_GEOKA 3-dehydroquinate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=aroB PE=3 SV=1 40 369 1.0E-56
sp|Q8K939|AROB_BUCAP 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroB PE=3 SV=1 15 386 1.0E-56
sp|A2C9Z1|AROB_PROM3 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=aroB PE=3 SV=1 59 372 1.0E-56
sp|A9BA66|AROB_PROM4 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=aroB PE=3 SV=1 61 385 1.0E-56
sp|B5XTU7|AROB_KLEP3 3-dehydroquinate synthase OS=Klebsiella pneumoniae (strain 342) GN=aroB PE=3 SV=1 45 381 2.0E-56
sp|Q8RU74|DHQS_SOLLC 3-dehydroquinate synthase, chloroplastic OS=Solanum lycopersicum GN=DHQS PE=2 SV=1 27 365 2.0E-56
sp|Q5M556|AROB_STRT2 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=aroB PE=3 SV=1 46 370 3.0E-56
sp|Q5M0M0|AROB_STRT1 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=aroB PE=3 SV=1 46 370 3.0E-56
sp|P59487|AROB_BUCBP 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aroB PE=3 SV=1 27 369 3.0E-56
sp|Q3Z988|AROB_DEHM1 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=aroB PE=3 SV=1 27 370 3.0E-56
sp|A7MKL4|AROB_CROS8 3-dehydroquinate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroB PE=3 SV=1 36 381 3.0E-56
sp|A4IYI9|AROB_FRATW 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=aroB PE=3 SV=1 19 377 3.0E-56
sp|A6W2T3|AROB_MARMS 3-dehydroquinate synthase OS=Marinomonas sp. (strain MWYL1) GN=aroB PE=3 SV=1 76 369 3.0E-56
sp|Q02EX9|AROB_PSEAB 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=aroB PE=3 SV=1 79 370 3.0E-56
sp|Q03LH4|AROB_STRTD 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=aroB PE=3 SV=1 46 370 4.0E-56
sp|A6TF13|AROB_KLEP7 3-dehydroquinate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aroB PE=3 SV=1 45 381 4.0E-56
sp|C1CEW4|AROB_STRZJ 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain JJA) GN=aroB PE=3 SV=1 45 369 4.0E-56
sp|P34002|AROB_PSEAE 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aroB PE=3 SV=2 79 370 4.0E-56
sp|A6VDF9|AROB_PSEA7 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=aroB PE=3 SV=1 27 370 4.0E-56
sp|A4VVS9|AROB_STRSY 3-dehydroquinate synthase OS=Streptococcus suis (strain 05ZYH33) GN=aroB PE=3 SV=1 75 370 4.0E-56
sp|A4W236|AROB_STRS2 3-dehydroquinate synthase OS=Streptococcus suis (strain 98HAH33) GN=aroB PE=3 SV=1 75 370 4.0E-56
sp|B4RQ17|AROB_NEIG2 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroB PE=3 SV=1 27 384 5.0E-56
sp|Q5FAD4|AROB_NEIG1 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroB PE=3 SV=1 27 384 5.0E-56
sp|A7I8L8|AROA_METB6 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanoregula boonei (strain 6A8) GN=aroA PE=3 SV=1 400 833 5.0E-56
sp|O50468|AROB_NEIGO 3-dehydroquinate synthase OS=Neisseria gonorrhoeae GN=aroB PE=3 SV=1 27 384 5.0E-56
sp|Q0BMF4|AROB_FRATO 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=aroB PE=3 SV=1 19 377 5.0E-56
sp|B7V3D1|AROB_PSEA8 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=aroB PE=3 SV=1 79 370 5.0E-56
sp|B1JIQ4|AROB_YERPY 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|Q664M0|AROB_YERPS 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|A4TGU2|AROB_YERPP 3-dehydroquinate synthase OS=Yersinia pestis (strain Pestoides F) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|Q1CCP0|AROB_YERPN 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|A9R4A9|AROB_YERPG 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|Q8ZJF6|AROB_YERPE 3-dehydroquinate synthase OS=Yersinia pestis GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|B2K5T4|AROB_YERPB 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|Q1C2P3|AROB_YERPA 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|A7FNT5|AROB_YERP3 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroB PE=3 SV=1 45 381 5.0E-56
sp|Q12SL8|AROB_SHEDO 3-dehydroquinate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aroB PE=3 SV=1 27 370 5.0E-56
sp|A2BW03|AROB_PROM5 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=aroB PE=3 SV=1 50 370 7.0E-56
sp|Q7V7S1|AROB_PROMM 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=aroB PE=3 SV=1 59 372 9.0E-56
sp|B1ZMW8|AROA_OPITP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=aroA PE=3 SV=1 406 836 9.0E-56
sp|Q5LSX9|AROB_RUEPO 3-dehydroquinate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aroB PE=3 SV=1 46 370 1.0E-55
sp|A1KS84|AROB_NEIMF 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroB PE=3 SV=1 79 384 1.0E-55
sp|Q9JY01|AROB_NEIMB 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroB PE=3 SV=1 79 384 1.0E-55
sp|Q9JVW5|AROB_NEIMA 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroB PE=3 SV=1 27 384 1.0E-55
sp|B0U6C7|AROB_XYLFM 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M12) GN=aroB PE=3 SV=1 77 390 1.0E-55
sp|A5CX62|AROB_VESOH 3-dehydroquinate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=aroB PE=3 SV=1 27 370 2.0E-55
sp|B8I359|AROB_CLOCE 3-dehydroquinate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=aroB PE=3 SV=1 31 373 2.0E-55
sp|Q98FY1|AROB_RHILO 3-dehydroquinate synthase OS=Rhizobium loti (strain MAFF303099) GN=aroB PE=3 SV=1 32 375 2.0E-55
sp|Q87DU9|AROB_XYLFT 3-dehydroquinate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=aroB PE=3 SV=1 77 390 2.0E-55
sp|B2I9G0|AROB_XYLF2 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M23) GN=aroB PE=3 SV=1 77 390 2.0E-55
sp|Q4ZZE3|AROB_PSEU2 3-dehydroquinate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aroB PE=3 SV=1 27 354 2.0E-55
sp|Q38X86|AROB_LACSS 3-dehydroquinate synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=aroB PE=3 SV=1 31 370 2.0E-55
sp|Q88CV2|AROB_PSEPK 3-dehydroquinate synthase OS=Pseudomonas putida (strain KT2440) GN=aroB PE=3 SV=1 74 393 2.0E-55
sp|A1WZA9|AROB_HALHL 3-dehydroquinate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=aroB PE=3 SV=1 82 369 2.0E-55
sp|Q2S2D3|AROB_SALRD 3-dehydroquinate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=aroB PE=3 SV=1 45 372 2.0E-55
sp|Q164J6|AROB_ROSDO 3-dehydroquinate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=aroB PE=3 SV=1 25 392 3.0E-55
sp|P57604|AROB_BUCAI 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aroB PE=3 SV=1 82 386 3.0E-55
sp|A8AQU3|AROB_CITK8 3-dehydroquinate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aroB PE=3 SV=1 45 381 4.0E-55
sp|Q4KJI8|AROB_PSEF5 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=aroB PE=3 SV=1 74 354 4.0E-55
sp|A4IQ88|AROB_GEOTN 3-dehydroquinate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=aroB PE=3 SV=1 40 369 4.0E-55
sp|B5E5N3|AROB_STRP4 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=aroB PE=3 SV=1 45 369 4.0E-55
[Show less]

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0004764 shikimate 3-dehydrogenase (NADP+) activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0003855 3-dehydroquinate dehydratase activity Yes
GO:0016491 oxidoreductase activity No
GO:0016836 hydro-lyase activity No
GO:0016829 lyase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016835 carbon-oxygen lyase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2893
MAHKPCSSQQTISILGEANIIADHGLWPEFIGTDLLRNTPSSTYVLVTDTNLYGTYVPPFRDWLEGLNDQRSRLL
TYAIPPGEASKCRETKAEIEDWMLSQQCTRDTVIIALGGGVIGDMIGYVAATFMRGVRFIQIPTTLLAMVDSSIG
GKTAIDTPMGKNLVGAFWQPCRIYIDLAFLDTLPAREFINGMAEVIKTAVIWDEIEFTFLEQSAAHILSCVRSGE
VDRLHSIRTLLKRIVINSARVKAEVVSKDEREAGLRNLLNFGHSIGHAIEAILAPQLLHGEAVAIGMVKEAELAR
FVGVLRPHAVARLAKCIAAFGLPTSLEDKRVIKLTAGKRCVVEEMLQKMSVDKKNDGGQKKVVLLSAIGQTHEAK
ASSVADQSIQLILASSVSVTPGVPKGLHVTVTPPGSKSISNRALVMAALGSGRCRVKNLLHSDDTEYMLSAIAQL
GGASYSWVDAGEVLEVEGRAGQLQATKDDLYVGNAGTASRFLTSVVALCSSEEATKSTVLTGNERMKSRPIGPLV
DALRCNGVEIEYLEQEQSLPLRIHAGGGLRGGLIELAATISSQYVSSILMAAPYAKNPVTLRLVGGKPISQSYID
MTISMMRSFGIDVVKSTDSDTYHIPQGAYRNPREYIIESDASSATYPLAVAAVTGTTCTVPNIGSRSLQGDARFA
VEVLRPMGCYVEQTEVATTVTGPVLGALHPLTHVDMEPMTDAFLTASVLAAVASGITQITGIANQRVKECNRIKA
MKDQLAKFGVECRELEDGIEIRGNSLLGLKAPEAAIHCYDDHRVAMSLSVLSLVSPGPAIITERECVGKTWPGWW
DTLSQSFQVTLDGVDEGSAAQHIPAQAQRSQQSILVVGMRGAGKTTVGQLMAAHLGWNFVDLDQELEKDSGSTIF
NMIGGPGGWEGFRRDELALLRHVMNTRFSGHIVSCGGGVVETTAARELLQAYLHSGGHVILVHRDIDRICEYLTK
DKSRPAYDSEIRQVYLKRKAWYEQCSDYTYYSLHGENPDCGDGIPQGLKSLISSIRGDGTCCDAIEAKTRSVFVS
LTLPDIKRARDRIRHIVVGADAVELRVDLLEDMTPNKVLEQVSILRDMVNMPIIFTVRSESQGGRFSDDRREERL
TLYRLALRLGVEYLDMEVTSDHETLQTVSDLRRHTRIIVSHHDPHGTLSWKNASWIPFYNKALQYGSIIKLVGTA
RTLEDNLDLANFKSRMQDARKVRLIAVNMGSAGKLSRLLNEFLTPVSHPDLPFPAAPGQLSAVEIRQGLALLGEI
KPLRFYLFGKPVSQSRSPALHNHLFQSAGLPHRYEFLETDNVVAVKAVLQDADFGGASVTIPLKRLVMDVVDELT
PAARAIGAINTIVPLASGAATNRRRLLGDNTDWKGIVCTLGQAGVSIRANGACAMILGSGGTTRAAIFALHSMGF
HPIYVVGRDPSRATAIAADFPDDYSIQVLDNPSTVSGLGTCINVIISTIPADAPIDATVNGVLAATLAHVQGQTG
CRVLLEMAYIPRVTPVMQLAEDIGGWTIITGLKVLASQGCSQVRCLTTG*
Coding >Hirsu2|2893
ATGGCACACAAACCATGCAGCTCACAGCAAACGATATCTATTTTAGGCGAAGCCAATATTATTGCGGACCATGGT
CTCTGGCCAGAATTCATCGGCACGGATCTCCTCCGCAACACACCATCGTCTACCTACGTCTTAGTAACCGACACG
AATCTCTATGGGACATACGTTCCACCGTTCAGAGACTGGCTTGAAGGCCTGAATGATCAGAGATCACGACTGTTA
ACCTATGCAATCCCACCAGGCGAGGCCTCAAAATGCCGCGAGACGAAGGCCGAGATTGAAGACTGGATGCTATCC
CAACAATGCACACGAGACACTGTCATCATCGCCCTGGGAGGGGGTGTCATCGGTGACATGATAGGATATGTGGCG
GCGACCTTTATGAGAGGCGTTCGATTCATTCAAATCCCAACTACACTTCTTGCAATGGTTGACTCATCGATCGGG
GGCAAAACAGCCATCGATACGCCCATGGGCAAGAACTTAGTCGGCGCCTTTTGGCAGCCCTGCCGGATTTACATT
GACCTGGCCTTCCTCGACACCCTCCCTGCTCGTGAGTTTATCAATGGCATGGCCGAGGTGATTAAGACGGCCGTC
ATCTGGGATGAGATCGAGTTTACCTTTTTGGAGCAGTCTGCCGCCCATATTCTATCATGTGTCCGCTCTGGCGAA
GTGGATCGTCTACATTCTATCAGGACCTTACTGAAACGAATCGTGATCAATTCAGCGCGCGTCAAGGCTGAAGTG
GTCTCCAAAGATGAGCGTGAGGCCGGTTTGCGCAACCTTCTTAACTTCGGTCACTCCATAGGCCATGCCATCGAG
GCTATCCTAGCTCCTCAGCTACTGCATGGCGAGGCAGTAGCCATTGGAATGGTCAAGGAAGCAGAACTAGCTCGA
TTCGTCGGCGTCTTGCGTCCCCATGCCGTCGCTAGGCTTGCGAAATGCATCGCCGCGTTTGGATTGCCCACCTCC
CTGGAGGACAAGCGAGTCATTAAGCTAACAGCTGGTAAGCGGTGCGTCGTGGAAGAGATGCTACAGAAGATGTCT
GTTGATAAGAAGAACGACGGGGGACAGAAGAAAGTTGTGCTACTATCTGCAATCGGTCAGACTCACGAAGCTAAA
GCCAGTTCTGTCGCGGACCAGTCTATTCAATTGATCCTCGCGTCCTCCGTCTCTGTCACGCCAGGAGTGCCCAAA
GGGCTCCATGTCACAGTCACGCCGCCAGGGTCCAAGAGCATCTCCAACAGGGCGCTTGTCATGGCGGCGTTGGGA
TCTGGCCGTTGCCGTGTCAAAAATTTGCTTCATTCCGATGACACCGAGTACATGCTATCCGCCATTGCTCAACTC
GGAGGCGCATCCTACTCGTGGGTGGACGCTGGTGAGGTGCTTGAGGTTGAGGGTAGAGCCGGACAGCTGCAAGCC
ACCAAGGACGATTTATACGTTGGCAATGCGGGAACCGCTTCTCGCTTTCTCACGTCTGTCGTGGCTCTCTGTTCC
TCGGAGGAAGCTACTAAATCGACAGTCCTGACCGGCAATGAGCGGATGAAGTCGCGTCCGATAGGACCTTTGGTT
GACGCGCTACGATGCAACGGTGTGGAGATTGAGTATTTGGAGCAAGAGCAGAGCCTACCGCTTCGGATCCATGCC
GGGGGCGGTTTGCGAGGTGGCTTGATTGAACTGGCCGCAACCATATCTTCCCAGTATGTATCGTCGATCCTCATG
GCGGCCCCGTATGCCAAAAATCCCGTTACACTCCGCTTGGTCGGTGGCAAGCCCATCTCCCAATCCTATATCGAC
ATGACAATTTCGATGATGCGATCGTTCGGAATTGATGTGGTCAAATCCACGGATTCAGATACATATCATATCCCC
CAAGGAGCATACCGAAATCCACGGGAATACATCATTGAAAGTGACGCAAGTTCGGCAACTTATCCGCTTGCCGTG
GCAGCAGTTACAGGGACAACCTGCACTGTCCCTAACATTGGGTCCCGATCTCTTCAAGGCGATGCACGATTCGCT
GTCGAAGTCCTACGGCCGATGGGTTGCTACGTTGAGCAAACCGAAGTCGCTACGACAGTCACTGGACCGGTGCTT
GGGGCCCTTCATCCTCTGACGCACGTGGATATGGAGCCTATGACAGACGCCTTTCTCACGGCCTCGGTGCTGGCA
GCAGTTGCAAGTGGCATAACCCAAATCACGGGAATCGCCAACCAGCGGGTCAAGGAATGCAACCGAATTAAAGCC
ATGAAAGATCAGCTGGCAAAATTCGGTGTTGAGTGCAGAGAGTTGGAGGATGGAATCGAAATCCGCGGAAACTCT
TTACTCGGTCTCAAAGCCCCCGAGGCCGCGATTCACTGCTACGACGATCACCGCGTTGCAATGAGCCTTAGCGTC
TTGTCCTTAGTGTCACCGGGCCCTGCCATCATCACGGAACGAGAATGTGTGGGGAAAACCTGGCCTGGGTGGTGG
GACACACTTTCCCAGTCATTTCAAGTGACTCTAGACGGAGTCGACGAGGGCTCTGCAGCGCAGCATATTCCCGCT
CAGGCGCAAAGATCCCAGCAATCAATACTCGTCGTCGGGATGAGGGGGGCAGGTAAAACTACGGTTGGACAGTTG
ATGGCGGCACATTTAGGCTGGAACTTCGTTGACCTGGATCAGGAGTTGGAAAAAGACTCTGGCTCAACCATTTTC
AATATGATCGGCGGCCCAGGAGGCTGGGAAGGCTTCCGACGGGACGAGTTGGCGCTCTTGCGTCATGTTATGAAC
ACACGATTCTCTGGTCACATTGTCTCCTGCGGTGGCGGAGTCGTCGAGACAACAGCGGCCAGGGAACTTTTGCAG
GCCTACCTTCACAGCGGTGGCCACGTCATCCTTGTCCATCGAGACATAGACCGAATTTGTGAATATTTGACGAAG
GACAAATCCCGACCCGCATACGATAGTGAAATTCGGCAGGTTTATCTCAAACGCAAAGCATGGTACGAGCAATGC
AGTGACTATACTTATTATAGCCTTCACGGCGAAAACCCCGACTGCGGAGATGGGATACCTCAGGGTTTGAAAAGT
TTAATATCTTCTATCCGCGGTGATGGCACTTGCTGCGACGCTATTGAGGCTAAGACGCGAAGTGTCTTTGTTTCG
CTGACGCTTCCTGACATCAAACGGGCGCGCGACAGAATCCGCCACATCGTCGTCGGAGCTGATGCTGTCGAGCTT
CGGGTGGATCTTCTGGAGGATATGACCCCGAACAAAGTTCTGGAACAAGTTTCGATTCTACGAGACATGGTCAAC
ATGCCTATCATTTTCACTGTTCGCAGTGAGTCTCAGGGAGGCCGCTTTTCTGACGACCGACGCGAGGAACGCCTT
ACGCTCTATCGTTTGGCATTACGATTAGGTGTGGAATATCTAGATATGGAGGTGACGTCTGATCACGAGACGCTG
CAGACCGTGTCAGATTTACGTCGGCATACGCGAATCATAGTCTCACACCACGACCCTCATGGCACACTGTCTTGG
AAAAATGCGTCGTGGATCCCATTTTATAACAAGGCGCTTCAGTATGGCAGCATCATTAAATTGGTTGGCACCGCT
CGGACATTGGAGGATAACCTCGATCTGGCCAACTTCAAATCCAGAATGCAGGATGCGCGAAAAGTCCGCTTAATC
GCCGTCAACATGGGAAGCGCCGGCAAACTCAGCCGCTTACTCAACGAGTTTCTTACCCCGGTTTCCCATCCCGAT
CTGCCATTTCCTGCCGCACCTGGTCAGCTGTCTGCGGTCGAGATCCGGCAGGGTCTGGCACTACTCGGCGAGATC
AAGCCCTTGAGATTCTACCTCTTTGGCAAACCCGTCTCCCAGTCGAGGTCCCCAGCCCTTCACAACCATCTGTTC
CAGAGCGCGGGCCTGCCGCATCGCTATGAATTTCTCGAGACTGACAATGTTGTGGCTGTAAAGGCCGTCCTACAG
GATGCAGACTTCGGCGGTGCCTCTGTCACCATACCGCTCAAACGGCTCGTCATGGACGTTGTCGATGAGTTGACG
CCTGCAGCCCGGGCTATAGGAGCCATCAACACGATAGTGCCACTGGCTTCTGGCGCTGCTACCAACCGTCGCCGC
CTCCTGGGAGACAATACAGACTGGAAGGGCATAGTCTGTACCCTCGGGCAGGCGGGAGTGTCTATAAGGGCCAAT
GGGGCCTGCGCAATGATCCTCGGCTCCGGAGGCACGACACGAGCAGCTATCTTCGCCTTGCACTCCATGGGCTTT
CACCCTATCTACGTTGTGGGACGAGACCCAAGCAGGGCCACAGCTATCGCAGCAGATTTTCCAGACGATTATTCC
ATTCAAGTTCTGGACAATCCTTCGACAGTTTCGGGACTGGGGACTTGTATTAATGTGATCATCAGCACCATACCC
GCGGACGCCCCAATCGACGCAACGGTAAATGGGGTGCTAGCGGCTACGCTAGCGCATGTTCAGGGTCAAACAGGG
TGCCGAGTTTTACTTGAAATGGCATATATACCCCGCGTTACCCCCGTCATGCAGTTGGCTGAGGACATAGGCGGA
TGGACCATTATTACTGGACTAAAGGTGCTCGCATCTCAAGGCTGCTCCCAGGTGCGTTGCCTAACAACAGGTTGA
Transcript >Hirsu2|2893
ATGGCACACAAACCATGCAGCTCACAGCAAACGATATCTATTTTAGGCGAAGCCAATATTATTGCGGACCATGGT
CTCTGGCCAGAATTCATCGGCACGGATCTCCTCCGCAACACACCATCGTCTACCTACGTCTTAGTAACCGACACG
AATCTCTATGGGACATACGTTCCACCGTTCAGAGACTGGCTTGAAGGCCTGAATGATCAGAGATCACGACTGTTA
ACCTATGCAATCCCACCAGGCGAGGCCTCAAAATGCCGCGAGACGAAGGCCGAGATTGAAGACTGGATGCTATCC
CAACAATGCACACGAGACACTGTCATCATCGCCCTGGGAGGGGGTGTCATCGGTGACATGATAGGATATGTGGCG
GCGACCTTTATGAGAGGCGTTCGATTCATTCAAATCCCAACTACACTTCTTGCAATGGTTGACTCATCGATCGGG
GGCAAAACAGCCATCGATACGCCCATGGGCAAGAACTTAGTCGGCGCCTTTTGGCAGCCCTGCCGGATTTACATT
GACCTGGCCTTCCTCGACACCCTCCCTGCTCGTGAGTTTATCAATGGCATGGCCGAGGTGATTAAGACGGCCGTC
ATCTGGGATGAGATCGAGTTTACCTTTTTGGAGCAGTCTGCCGCCCATATTCTATCATGTGTCCGCTCTGGCGAA
GTGGATCGTCTACATTCTATCAGGACCTTACTGAAACGAATCGTGATCAATTCAGCGCGCGTCAAGGCTGAAGTG
GTCTCCAAAGATGAGCGTGAGGCCGGTTTGCGCAACCTTCTTAACTTCGGTCACTCCATAGGCCATGCCATCGAG
GCTATCCTAGCTCCTCAGCTACTGCATGGCGAGGCAGTAGCCATTGGAATGGTCAAGGAAGCAGAACTAGCTCGA
TTCGTCGGCGTCTTGCGTCCCCATGCCGTCGCTAGGCTTGCGAAATGCATCGCCGCGTTTGGATTGCCCACCTCC
CTGGAGGACAAGCGAGTCATTAAGCTAACAGCTGGTAAGCGGTGCGTCGTGGAAGAGATGCTACAGAAGATGTCT
GTTGATAAGAAGAACGACGGGGGACAGAAGAAAGTTGTGCTACTATCTGCAATCGGTCAGACTCACGAAGCTAAA
GCCAGTTCTGTCGCGGACCAGTCTATTCAATTGATCCTCGCGTCCTCCGTCTCTGTCACGCCAGGAGTGCCCAAA
GGGCTCCATGTCACAGTCACGCCGCCAGGGTCCAAGAGCATCTCCAACAGGGCGCTTGTCATGGCGGCGTTGGGA
TCTGGCCGTTGCCGTGTCAAAAATTTGCTTCATTCCGATGACACCGAGTACATGCTATCCGCCATTGCTCAACTC
GGAGGCGCATCCTACTCGTGGGTGGACGCTGGTGAGGTGCTTGAGGTTGAGGGTAGAGCCGGACAGCTGCAAGCC
ACCAAGGACGATTTATACGTTGGCAATGCGGGAACCGCTTCTCGCTTTCTCACGTCTGTCGTGGCTCTCTGTTCC
TCGGAGGAAGCTACTAAATCGACAGTCCTGACCGGCAATGAGCGGATGAAGTCGCGTCCGATAGGACCTTTGGTT
GACGCGCTACGATGCAACGGTGTGGAGATTGAGTATTTGGAGCAAGAGCAGAGCCTACCGCTTCGGATCCATGCC
GGGGGCGGTTTGCGAGGTGGCTTGATTGAACTGGCCGCAACCATATCTTCCCAGTATGTATCGTCGATCCTCATG
GCGGCCCCGTATGCCAAAAATCCCGTTACACTCCGCTTGGTCGGTGGCAAGCCCATCTCCCAATCCTATATCGAC
ATGACAATTTCGATGATGCGATCGTTCGGAATTGATGTGGTCAAATCCACGGATTCAGATACATATCATATCCCC
CAAGGAGCATACCGAAATCCACGGGAATACATCATTGAAAGTGACGCAAGTTCGGCAACTTATCCGCTTGCCGTG
GCAGCAGTTACAGGGACAACCTGCACTGTCCCTAACATTGGGTCCCGATCTCTTCAAGGCGATGCACGATTCGCT
GTCGAAGTCCTACGGCCGATGGGTTGCTACGTTGAGCAAACCGAAGTCGCTACGACAGTCACTGGACCGGTGCTT
GGGGCCCTTCATCCTCTGACGCACGTGGATATGGAGCCTATGACAGACGCCTTTCTCACGGCCTCGGTGCTGGCA
GCAGTTGCAAGTGGCATAACCCAAATCACGGGAATCGCCAACCAGCGGGTCAAGGAATGCAACCGAATTAAAGCC
ATGAAAGATCAGCTGGCAAAATTCGGTGTTGAGTGCAGAGAGTTGGAGGATGGAATCGAAATCCGCGGAAACTCT
TTACTCGGTCTCAAAGCCCCCGAGGCCGCGATTCACTGCTACGACGATCACCGCGTTGCAATGAGCCTTAGCGTC
TTGTCCTTAGTGTCACCGGGCCCTGCCATCATCACGGAACGAGAATGTGTGGGGAAAACCTGGCCTGGGTGGTGG
GACACACTTTCCCAGTCATTTCAAGTGACTCTAGACGGAGTCGACGAGGGCTCTGCAGCGCAGCATATTCCCGCT
CAGGCGCAAAGATCCCAGCAATCAATACTCGTCGTCGGGATGAGGGGGGCAGGTAAAACTACGGTTGGACAGTTG
ATGGCGGCACATTTAGGCTGGAACTTCGTTGACCTGGATCAGGAGTTGGAAAAAGACTCTGGCTCAACCATTTTC
AATATGATCGGCGGCCCAGGAGGCTGGGAAGGCTTCCGACGGGACGAGTTGGCGCTCTTGCGTCATGTTATGAAC
ACACGATTCTCTGGTCACATTGTCTCCTGCGGTGGCGGAGTCGTCGAGACAACAGCGGCCAGGGAACTTTTGCAG
GCCTACCTTCACAGCGGTGGCCACGTCATCCTTGTCCATCGAGACATAGACCGAATTTGTGAATATTTGACGAAG
GACAAATCCCGACCCGCATACGATAGTGAAATTCGGCAGGTTTATCTCAAACGCAAAGCATGGTACGAGCAATGC
AGTGACTATACTTATTATAGCCTTCACGGCGAAAACCCCGACTGCGGAGATGGGATACCTCAGGGTTTGAAAAGT
TTAATATCTTCTATCCGCGGTGATGGCACTTGCTGCGACGCTATTGAGGCTAAGACGCGAAGTGTCTTTGTTTCG
CTGACGCTTCCTGACATCAAACGGGCGCGCGACAGAATCCGCCACATCGTCGTCGGAGCTGATGCTGTCGAGCTT
CGGGTGGATCTTCTGGAGGATATGACCCCGAACAAAGTTCTGGAACAAGTTTCGATTCTACGAGACATGGTCAAC
ATGCCTATCATTTTCACTGTTCGCAGTGAGTCTCAGGGAGGCCGCTTTTCTGACGACCGACGCGAGGAACGCCTT
ACGCTCTATCGTTTGGCATTACGATTAGGTGTGGAATATCTAGATATGGAGGTGACGTCTGATCACGAGACGCTG
CAGACCGTGTCAGATTTACGTCGGCATACGCGAATCATAGTCTCACACCACGACCCTCATGGCACACTGTCTTGG
AAAAATGCGTCGTGGATCCCATTTTATAACAAGGCGCTTCAGTATGGCAGCATCATTAAATTGGTTGGCACCGCT
CGGACATTGGAGGATAACCTCGATCTGGCCAACTTCAAATCCAGAATGCAGGATGCGCGAAAAGTCCGCTTAATC
GCCGTCAACATGGGAAGCGCCGGCAAACTCAGCCGCTTACTCAACGAGTTTCTTACCCCGGTTTCCCATCCCGAT
CTGCCATTTCCTGCCGCACCTGGTCAGCTGTCTGCGGTCGAGATCCGGCAGGGTCTGGCACTACTCGGCGAGATC
AAGCCCTTGAGATTCTACCTCTTTGGCAAACCCGTCTCCCAGTCGAGGTCCCCAGCCCTTCACAACCATCTGTTC
CAGAGCGCGGGCCTGCCGCATCGCTATGAATTTCTCGAGACTGACAATGTTGTGGCTGTAAAGGCCGTCCTACAG
GATGCAGACTTCGGCGGTGCCTCTGTCACCATACCGCTCAAACGGCTCGTCATGGACGTTGTCGATGAGTTGACG
CCTGCAGCCCGGGCTATAGGAGCCATCAACACGATAGTGCCACTGGCTTCTGGCGCTGCTACCAACCGTCGCCGC
CTCCTGGGAGACAATACAGACTGGAAGGGCATAGTCTGTACCCTCGGGCAGGCGGGAGTGTCTATAAGGGCCAAT
GGGGCCTGCGCAATGATCCTCGGCTCCGGAGGCACGACACGAGCAGCTATCTTCGCCTTGCACTCCATGGGCTTT
CACCCTATCTACGTTGTGGGACGAGACCCAAGCAGGGCCACAGCTATCGCAGCAGATTTTCCAGACGATTATTCC
ATTCAAGTTCTGGACAATCCTTCGACAGTTTCGGGACTGGGGACTTGTATTAATGTGATCATCAGCACCATACCC
GCGGACGCCCCAATCGACGCAACGGTAAATGGGGTGCTAGCGGCTACGCTAGCGCATGTTCAGGGTCAAACAGGG
TGCCGAGTTTTACTTGAAATGGCATATATACCCCGCGTTACCCCCGTCATGCAGTTGGCTGAGGACATAGGCGGA
TGGACCATTATTACTGGACTAAAGGTGCTCGCATCTCAAGGCTGCTCCCAGGTGCGTTGCCTAACAACAGGTTGA
Gene >Hirsu2|2893
ATGGCACACAAACCATGCAGCTCACAGCAAACGATATCTATTTTAGGCGAAGCCAATATTATTGCGGACCATGGT
CTCTGGCCAGAATTCATCGGCACGGATCTCCTCCGCAACACACCATCGTCTACCTACGTCTTAGTAACCGACACG
AATCTCTATGGGACATACGTTCCACCGTTCAGAGACTGGCTTGAAGGCCTGAATGATCAGAGATCACGACTGTTA
ACCTATGCAATCCCACCAGGCGAGGCCTCAAAATGCCGCGAGACGAAGGCCGAGATTGAAGACTGGATGCTATCC
CAACAATGCACACGAGACACTGTCATCATCGCCCTGGGAGGGGGTGTCATCGGTGACATGATAGGATATGTGGCG
GCGACCTTTATGAGAGGCGTTCGATTCATTCAAATCCCAACTACACTTCTTGCAATGGTTGACTCATCGATCGGG
GGCAAAACAGCCATCGATACGCCCATGGGCAAGAACTTAGTCGGCGCCTTTTGGCAGCCCTGCCGGATTTACATT
GACCTGGCCTTCCTCGACACCCTCCCTGCTCGTGAGTTTATCAATGGCATGGCCGAGGTGATTAAGACGGCCGTC
ATCTGGGATGAGATCGAGTTTACCTTTTTGGAGCAGTCTGCCGCCCATATTCTATCATGTGTCCGCTCTGGCGAA
GTGGATCGTCTACATTCTATCAGGACCTTACTGAAACGAATCGTGATCAATTCAGCGCGCGTCAAGGCTGAAGTG
GTCTCCAAAGATGAGCGTGAGGCCGGTTTGCGCAACCTTCTTAACTTCGGTCACTCCATAGGCCATGCCATCGAG
GCTATCCTAGCTCCTCAGCTACTGCATGGCGAGGCAGTAGCCATTGGAATGGTCAAGGAAGCAGAACTAGCTCGA
TTCGTCGGCGTCTTGCGTCCCCATGCCGTCGCTAGGCTTGCGAAATGCATCGCCGCGTTTGGATTGCCCACCTCC
CTGGAGGACAAGCGAGTCATTAAGCTAACAGCTGGTAAGCGGTGCGTCGTGGAAGAGATGCTACAGAAGATGTCT
GTTGATAAGAAGAACGACGGGGGACAGAAGAAAGTTGTGCTACTATCTGCAATCGGTCAGACTCACGAAGCTAAA
GCCAGTTCTGTCGCGGACCAGTCTATTCAATTGATCCTCGCGTCCTCCGTCTCTGTCACGCCAGGAGTGCCCAAA
GGGCTCCATGTCACAGTCACGCCGCCAGGGTCCAAGAGCATCTCCAACAGGGCGCTTGTCATGGCGGCGTTGGGA
TCTGGCCGTTGCCGTGTCAAAAATTTGCTTCATTCCGATGACACCGAGTACATGCTATCCGCCATTGCTCAACTC
GGAGGCGCATCCTACTCGTGGGTGGACGCTGGTGAGGTGCTTGAGGTTGAGGGTAGAGCCGGACAGCTGCAAGCC
ACCAAGGACGATTTATACGTTGGCAATGCGGGAACCGCTTCTCGCTTTCTCACGTCTGTCGTGGCTCTCTGTTCC
TCGGAGGAAGCTACTAAATCGACAGTCCTGACCGGCAATGAGCGGATGAAGTCGCGTCCGATAGGACCTTTGGTT
GACGCGCTACGATGCAACGGTGTGGAGATTGAGTATTTGGAGCAAGAGCAGAGCCTACCGCTTCGGATCCATGCC
GGGGGCGGTTTGCGAGGTGGCTTGATTGAACTGGCCGCAACCATATCTTCCCAGTATGTATCGTCGATCCTCATG
GCGGCCCCGTATGCCAAAAATCCCGTTACACTCCGCTTGGTCGGTGGCAAGCCCATCTCCCAATCCTATATCGAC
ATGACAATTTCGATGATGCGATCGTTCGGAATTGATGTGGTCAAATCCACGGATTCAGATACATATCATATCCCC
CAAGGAGCATACCGAAATCCACGGGAATACATCATTGAAAGTGACGCAAGTTCGGCAACTTATCCGCTTGCCGTG
GCAGCAGTTACAGGGACAACCTGCACTGTCCCTAACATTGGGTCCCGATCTCTTCAAGGCGATGCACGATTCGCT
GTCGAAGTCCTACGGCCGATGGGTTGCTACGTTGAGCAAACCGAAGTCGCTACGACAGTCACTGGACCGGTGCTT
GGGGCCCTTCATCCTCTGACGCACGTGGATATGGAGCCTATGACAGACGCCTTTCTCACGGCCTCGGTGCTGGCA
GCAGTTGCAAGTGGCATAACCCAAATCACGGGAATCGCCAACCAGCGGGTCAAGGAATGCAACCGAATTAAAGCC
ATGAAAGATCAGCTGGCAAAATTCGGTGTTGAGTGCAGAGAGTTGGAGGATGGAATCGAAATCCGCGGAAACTCT
TTACTCGGTCTCAAAGCCCCCGAGGCCGCGATTCACTGCTACGACGATCACCGCGTTGCAATGAGCCTTAGCGTC
TTGTCCTTAGTGTCACCGGGCCCTGCCATCATCACGGAACGAGAATGTGTGGGGAAAACCTGGCCTGGGTGGTGG
GACACACTTTCCCAGTCATTTCAAGTGACTCTAGACGGAGTCGACGAGGGCTCTGCAGCGCAGCATATTCCCGCT
CAGGCGCAAAGATCCCAGCAATCAATACTCGTCGTCGGGATGAGGGGGGCAGGTAAAACTACGGTTGGACAGTTG
ATGGCGGCACATTTAGGCTGGAACTTCGTTGACCTGGATCAGGAGTTGGAAAAAGACTCTGGCTCAACCATTTTC
AATATGATCGGCGGCCCAGGAGGCTGGGAAGGCTTCCGACGGGACGAGTTGGCGCTCTTGCGTCATGTTATGAAC
ACACGATTCTCTGGTCACATTGTCTCCTGCGGTGGCGGAGTCGTCGAGACAACAGCGGCCAGGGAACTTTTGCAG
GCCTACCTTCACAGCGGTGGCCACGTCATCCTTGTCCATCGAGACATAGACCGAATTTGTGAATATTTGACGAAG
GACAAATCCCGACCCGCATACGATAGTGAAATTCGGCAGGTTTATCTCAAACGCAAAGCATGGTACGAGCAATGC
AGTGACTATACTTATTATAGCCTTCACGGCGAAAACCCCGACTGCGGAGATGGGATACCTCAGGGTTTGAAAAGT
TTAATATCTTCTATCCGCGGTGATGGCACTTGCTGCGACGCTATTGAGGCTAAGACGCGAAGTGTCTTTGTTTCG
CTGACGCTTCCTGACATCAAACGGGCGCGCGACAGAATCCGCCACATCGTCGTCGGAGCTGATGCTGTCGAGCTT
CGGGTGGATCTTCTGGAGGATATGACCCCGAACAAAGTTCTGGAACAAGTTTCGATTCTACGAGACATGGTCAAC
ATGCCTATCATTTTCACTGTTCGCAGTGAGTCTCAGGGAGGCCGCTTTTCTGACGACCGACGCGAGGAACGCCTT
ACGCTCTATCGTTTGGCATTACGATTAGGTGTGGAATATCTAGATATGGAGGTGACGTCTGATCACGAGACGCTG
CAGACCGTGTCAGATTTACGTCGGCATACGCGAATCATAGTCTCACACCACGACCCTCATGGCACACTGTCTTGG
AAAAATGCGTCGTGGATCCCATTTTATAACAAGGCGCTTCAGTATGGCAGCATCATTAAATTGGTTGGCACCGCT
CGGACATTGGAGGATAACCTCGATCTGGCCAACTTCAAATCCAGAATGCAGGATGCGCGAAAAGTCCGCTTAATC
GCCGTCAACATGGGAAGCGCCGGCAAACTCAGCCGCTTACTCAACGAGTTTCTTACCCCGGTTTCCCATCCCGAT
CTGCCATTTCCTGCCGCACCTGGTCAGCTGTCTGCGGTCGAGATCCGGCAGGGTCTGGCACTACTCGGCGAGATC
AAGCCCTTGAGATTCTACCTCTTTGGCAAACCCGTCTCCCAGTCGAGGTCCCCAGCCCTTCACAACCATCTGTTC
CAGAGCGCGGGCCTGCCGCATCGCTATGAATTTCTCGAGACTGACAATGTTGTGGCTGTAAAGGCCGTCCTACAG
GATGCAGACTTCGGCGGTGCCTCTGTCACCATACCGCTCAAACGGCTCGTCATGGACGTTGTCGATGAGTTGACG
CCTGCAGCCCGGGCTATAGGAGCCATCAACACGATAGTGCCACTGGCTTCTGGCGCTGCTACCAACCGTCGCCGC
CTCCTGGGAGACAATACAGACTGGAAGGGCATAGTCTGTACCCTCGGGCAGGCGGGAGTGTCTATAAGGGCCAAT
GGGGCCTGCGCAATGATCCTCGGCTCCGGAGGCACGACACGAGCAGCTATCTTCGCCTTGCACTCCATGGGCTTT
CACCCTATCTACGTTGTGGGACGAGACCCAAGCAGGGCCACAGCTATCGCAGCAGATTTTCCAGACGATTATTCC
ATTCAAGTTCTGGACAATCCTTCGACAGTTTCGGGACTGGGGACTTGTATTAATGTGATCATCAGCACCATACCC
GCGGACGCCCCAATCGACGCAACGGTAAATGGGGTGCTAGCGGCTACGCTAGCGCATGTTCAGGGTCAAACAGGG
TGCCGAGTTTTACTTGAAATGGCATATATACCCCGCGTTACCCCCGTCATGCAGTTGGCTGAGGACATAGGCGGA
TGGACCATTATTACTGGACTAAAGGTGCTCGCATCTCAAGGCTGCTCCCAGGTGCGTTGCCTAACAACAGGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail