Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2886
Gene name
LocationContig_1711:2000..3982
Strand-
Gene length (bp)1982
Transcript length (bp)1734
Coding sequence length (bp)1734
Protein length (aa) 578

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 9.2E-33 413 561
PF08022 FAD_binding_8 FAD-binding domain 1.6E-17 288 406
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.4E-17 111 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XYS3|NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum GN=noxA PE=2 SV=1 40 577 2.0E-120
sp|Q95L74|CY24B_BISBI Cytochrome b-245 heavy chain OS=Bison bison GN=CYBB PE=2 SV=1 48 577 1.0E-105
sp|O46522|CY24B_BOVIN Cytochrome b-245 heavy chain OS=Bos taurus GN=CYBB PE=2 SV=1 48 577 2.0E-105
sp|P04839|CY24B_HUMAN Cytochrome b-245 heavy chain OS=Homo sapiens GN=CYBB PE=1 SV=2 48 577 2.0E-103
sp|Q61093|CY24B_MOUSE Cytochrome b-245 heavy chain OS=Mus musculus GN=Cybb PE=1 SV=1 48 577 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XYS3|NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum GN=noxA PE=2 SV=1 40 577 2.0E-120
sp|Q95L74|CY24B_BISBI Cytochrome b-245 heavy chain OS=Bison bison GN=CYBB PE=2 SV=1 48 577 1.0E-105
sp|O46522|CY24B_BOVIN Cytochrome b-245 heavy chain OS=Bos taurus GN=CYBB PE=2 SV=1 48 577 2.0E-105
sp|P04839|CY24B_HUMAN Cytochrome b-245 heavy chain OS=Homo sapiens GN=CYBB PE=1 SV=2 48 577 2.0E-103
sp|Q61093|CY24B_MOUSE Cytochrome b-245 heavy chain OS=Mus musculus GN=Cybb PE=1 SV=1 48 577 2.0E-102
sp|Q9HBY0|NOX3_HUMAN NADPH oxidase 3 OS=Homo sapiens GN=NOX3 PE=1 SV=1 49 577 4.0E-101
sp|Q9Y5S8|NOX1_HUMAN NADPH oxidase 1 OS=Homo sapiens GN=NOX1 PE=1 SV=2 49 577 1.0E-100
sp|Q672K1|NOX3_RAT NADPH oxidase 3 OS=Rattus norvegicus GN=Nox3 PE=2 SV=1 49 577 1.0E-99
sp|Q672J9|NOX3_MOUSE NADPH oxidase 3 OS=Mus musculus GN=Nox3 PE=1 SV=2 49 577 2.0E-97
sp|P52649|CY24B_PIG Cytochrome b-245 heavy chain (Fragment) OS=Sus scrofa GN=CYBB PE=2 SV=2 134 577 6.0E-95
sp|Q8CIZ9|NOX1_MOUSE NADPH oxidase 1 OS=Mus musculus GN=Nox1 PE=1 SV=2 49 577 5.0E-92
sp|Q9WV87|NOX1_RAT NADPH oxidase 1 OS=Rattus norvegicus GN=Nox1 PE=2 SV=1 49 577 2.0E-91
sp|Q86GL4|NOXB_DICDI Superoxide-generating NADPH oxidase heavy chain subunit B OS=Dictyostelium discoideum GN=noxB PE=2 SV=1 89 577 2.0E-81
sp|O48538|RBOHF_ARATH Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana GN=RBOHF PE=1 SV=1 49 577 1.0E-76
sp|Q948T9|RBOHB_SOLTU Respiratory burst oxidase homolog protein B OS=Solanum tuberosum GN=RBOHB PE=1 SV=1 1 577 1.0E-76
sp|Q5R5C5|NOX4_PONAB NADPH oxidase 4 OS=Pongo abelii GN=NOX4 PE=2 SV=2 49 577 1.0E-75
sp|Q9NPH5|NOX4_HUMAN NADPH oxidase 4 OS=Homo sapiens GN=NOX4 PE=1 SV=2 49 577 1.0E-75
sp|Q9JHI8|NOX4_MOUSE NADPH oxidase 4 OS=Mus musculus GN=Nox4 PE=1 SV=1 49 577 2.0E-72
sp|Q924V1|NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus GN=Nox4 PE=1 SV=2 49 577 2.0E-72
sp|O81210|RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana GN=RBOHC PE=2 SV=2 25 577 2.0E-71
sp|Q948U0|RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum GN=RBOHA PE=1 SV=1 49 577 5.0E-70
sp|Q2HXK9|RBOHD_SOLTU Respiratory burst oxidase homolog protein D OS=Solanum tuberosum GN=RBOHD PE=1 SV=2 48 577 2.0E-69
sp|Q9SW17|RBOHG_ARATH Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana GN=RBOHG PE=2 SV=2 1 577 3.0E-69
sp|Q9FIJ0|RBOHD_ARATH Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana GN=RBOHD PE=1 SV=1 1 577 3.0E-69
sp|Q9SUT8|RBOHI_ARATH Probable respiratory burst oxidase homolog protein I OS=Arabidopsis thaliana GN=RBOHI PE=3 SV=2 37 577 3.0E-69
sp|Q54F44|NOXC_DICDI Superoxide-generating NADPH oxidase heavy chain subunit C OS=Dictyostelium discoideum GN=noxC PE=2 SV=1 34 577 6.0E-69
sp|Q2HXL0|RBOHC_SOLTU Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2 23 577 2.0E-68
sp|O81209|RBOHA_ARATH Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana GN=RBOHA PE=2 SV=2 23 577 2.0E-67
sp|Q9FJD6|RBOHH_ARATH Putative respiratory burst oxidase homolog protein H OS=Arabidopsis thaliana GN=RBOHH PE=3 SV=1 1 577 7.0E-67
sp|Q9SBI0|RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1 37 577 7.0E-66
sp|Q5ZAJ0|RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica GN=RBOHB PE=1 SV=1 90 577 8.0E-66
sp|Q6J2K5|RBOHB_ORYSI Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. indica GN=RBOHB PE=2 SV=1 90 577 8.0E-66
sp|O81211|RBOHE_ARATH Respiratory burst oxidase homolog protein E OS=Arabidopsis thaliana GN=RBOHE PE=2 SV=2 32 577 8.0E-64
sp|Q8HZK2|DUOX2_PIG Dual oxidase 2 OS=Sus scrofa GN=DUOX2 PE=1 SV=2 28 577 8.0E-63
sp|Q9ES45|DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus GN=Duox2 PE=2 SV=1 28 577 1.0E-61
sp|Q9NRD8|DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens GN=DUOX2 PE=1 SV=2 28 561 6.0E-61
sp|Q8CIY2|DUOX1_RAT Dual oxidase 1 OS=Rattus norvegicus GN=Duox1 PE=1 SV=1 41 577 2.0E-60
sp|Q9MZF4|DUOX1_CANLF Dual oxidase 1 OS=Canis lupus familiaris GN=DUOX1 PE=1 SV=1 27 577 2.0E-60
sp|Q8HZK3|DUOX1_PIG Dual oxidase 1 OS=Sus scrofa GN=DUOX1 PE=2 SV=1 41 577 3.0E-60
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 27 577 2.0E-59
sp|Q9VQH2|DUOX_DROME Dual oxidase OS=Drosophila melanogaster GN=Duox PE=1 SV=2 58 562 4.0E-57
sp|Q96PH1|NOX5_HUMAN NADPH oxidase 5 OS=Homo sapiens GN=NOX5 PE=1 SV=1 62 577 4.0E-57
sp|Q9LZU9|RBOHJ_ARATH Putative respiratory burst oxidase homolog protein J OS=Arabidopsis thaliana GN=RBOHJ PE=3 SV=2 89 577 4.0E-56
sp|O61213|DUOX1_CAEEL Dual oxidase 1 OS=Caenorhabditis elegans GN=bli-3 PE=1 SV=2 53 560 1.0E-46
sp|Q8VY13|FRO8_ARATH Ferric reduction oxidase 8, mitochondrial OS=Arabidopsis thaliana GN=FRO8 PE=2 SV=1 95 501 2.0E-23
sp|Q9FLW2|FRO5_ARATH Ferric reduction oxidase 5 OS=Arabidopsis thaliana GN=FRO5 PE=2 SV=1 112 499 4.0E-21
sp|Q8W110|FRO4_ARATH Ferric reduction oxidase 4 OS=Arabidopsis thaliana GN=FRO4 PE=2 SV=1 112 499 7.0E-20
sp|Q3KTM0|FRO7_ARATH Ferric reduction oxidase 7, chloroplastic OS=Arabidopsis thaliana GN=FRO7 PE=2 SV=1 191 491 1.0E-17
sp|Q8RWS6|FRO6_ARATH Ferric reduction oxidase 6 OS=Arabidopsis thaliana GN=FRO6 PE=2 SV=1 191 491 2.0E-17
sp|P92949|FRO2_ARATH Ferric reduction oxidase 2 OS=Arabidopsis thaliana GN=FRO2 PE=1 SV=2 191 509 2.0E-16
sp|F4I4K7|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial OS=Arabidopsis thaliana GN=FRO3 PE=2 SV=1 191 437 7.0E-16
sp|Q9LMM2|FRO1_ARATH Probable ferric reduction oxidase 1 OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 191 437 2.0E-15
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 191 564 4.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 117 22
3 138 160 22
4 175 197 22
5 218 240 22
6 250 272 22
7 311 330 19
8 415 437 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2886
MEYYDYDYAGYDRPSERSRWSPLTRMLLSGEMTQEKQQVLSTRERFDRWMINEGYRRFFVFLFMLAHALIFAFAS
VHYAVKDSLQSARDIFGFTYVIARASAVVLHVDVGIILFPVCRTLISLLRQTPLNGIIQFDKNITFHITTAWSIV
FWSWVHTIAHWNNFAQVAAKNRLGFYGWLLANFASGPGWTGYVMLVALMGMVVTSIEKPRRANYERFWYTHHMFI
LFFFFWSLHGAFCMIQPDVAPFCTSIGASAIGVFWQYWMYGGFVYLAERVARELRGRHKTYISKVIQHPSQVCEI
QIKKEHTKTRAGQYIFFCCPAVSLWQYHPFTLTSAPEEDYISIHMRCQGDFTMAVSAALGCEWAGCKKNGTDASK
VVGVDEDNGAVDPVLRRLLPRVYIDGPFGSASEDVFKYEVSVLVGAGIGVTPFASILKSIWYRMNYPQKKTRLSK
VYFFWICRDFGSFEWFRSLLLAVEAQDVEHRIEIHTYLTAKIKSDDATNIMINDANADKDTITGLRSPTNFGRPN
WDMIFRSIRKLHSPGEAGVFFCGPKGLGSSLHVYCNKYTEPGFSFVWGKENF*
Coding >Hirsu2|2886
ATGGAATACTACGACTACGACTACGCCGGCTACGACCGGCCCTCGGAGCGGTCGAGATGGTCCCCGCTCACCCGC
ATGCTGCTGTCGGGCGAGATGACGCAGGAGAAACAGCAGGTGCTGTCGACGAGAGAACGGTTTGACCGATGGATG
ATCAACGAGGGCTACCGAAGATTCTTCGTCTTCCTCTTCATGCTGGCGCACGCCCTCATCTTCGCATTCGCCTCG
GTCCACTACGCCGTCAAGGACAGCCTGCAAAGCGCGCGAGACATCTTCGGCTTCACCTACGTCATCGCCCGCGCG
TCGGCCGTCGTGCTGCACGTCGATGTCGGCATCATTCTCTTCCCCGTCTGCCGCACCCTCATCTCGCTCCTGCGC
CAGACGCCGCTCAACGGCATCATCCAGTTCGACAAGAACATCACCTTTCACATCACGACGGCCTGGTCCATCGTC
TTCTGGTCCTGGGTTCACACCATCGCGCACTGGAACAACTTCGCCCAGGTGGCGGCCAAGAACCGGCTCGGCTTC
TACGGCTGGCTGCTCGCCAACTTCGCCTCGGGCCCCGGATGGACGGGCTACGTCATGCTCGTCGCCCTCATGGGC
ATGGTGGTGACGTCGATCGAGAAGCCGCGCCGGGCCAACTACGAGCGCTTCTGGTACACGCACCACATGTTCATC
CTCTTCTTTTTCTTCTGGTCCCTGCACGGCGCCTTCTGCATGATCCAGCCGGACGTGGCGCCCTTCTGCACCAGC
ATCGGCGCCTCGGCCATCGGCGTCTTCTGGCAGTACTGGATGTACGGCGGCTTCGTCTACCTGGCCGAGCGGGTG
GCGCGCGAGCTGCGCGGCCGGCACAAGACGTACATCTCCAAGGTGATCCAGCACCCGAGCCAGGTGTGCGAGATC
CAGATCAAGAAGGAGCACACCAAGACGCGCGCGGGCCAGTACATCTTCTTCTGCTGCCCGGCCGTGTCGCTGTGG
CAGTACCACCCGTTCACGCTGACGAGCGCGCCCGAGGAGGACTACATCTCGATCCACATGCGCTGCCAGGGCGAC
TTCACCATGGCCGTCTCGGCCGCCCTCGGCTGCGAGTGGGCCGGCTGCAAGAAGAACGGGACCGACGCGAGCAAG
GTGGTGGGCGTGGACGAGGACAACGGCGCCGTCGACCCGGTGCTGCGGCGGCTGCTGCCGCGCGTCTACATCGAC
GGGCCCTTTGGCTCGGCGTCGGAGGACGTGTTCAAGTACGAGGTGTCGGTACTGGTGGGCGCCGGCATCGGCGTG
ACGCCCTTTGCGTCGATCCTCAAGTCGATCTGGTACCGGATGAACTACCCGCAGAAGAAGACGCGGCTGTCCAAG
GTCTACTTCTTCTGGATCTGCCGCGACTTCGGCTCCTTCGAGTGGTTCCGCTCGCTGCTGCTGGCCGTCGAGGCG
CAGGACGTCGAGCACCGCATCGAGATCCACACGTACCTGACGGCCAAGATCAAGTCGGACGACGCGACCAACATC
ATGATCAACGACGCCAACGCCGACAAGGACACCATCACGGGGCTGCGGAGCCCGACCAACTTTGGCCGGCCCAAC
TGGGACATGATCTTCCGGAGCATCCGGAAGCTGCACTCGCCGGGCGAGGCCGGCGTCTTCTTCTGCGGGCCCAAG
GGCCTGGGCAGCTCGCTGCACGTGTACTGCAACAAGTACACGGAGCCCGGCTTCTCGTTTGTCTGGGGCAAGGAG
AACTTTTAG
Transcript >Hirsu2|2886
ATGGAATACTACGACTACGACTACGCCGGCTACGACCGGCCCTCGGAGCGGTCGAGATGGTCCCCGCTCACCCGC
ATGCTGCTGTCGGGCGAGATGACGCAGGAGAAACAGCAGGTGCTGTCGACGAGAGAACGGTTTGACCGATGGATG
ATCAACGAGGGCTACCGAAGATTCTTCGTCTTCCTCTTCATGCTGGCGCACGCCCTCATCTTCGCATTCGCCTCG
GTCCACTACGCCGTCAAGGACAGCCTGCAAAGCGCGCGAGACATCTTCGGCTTCACCTACGTCATCGCCCGCGCG
TCGGCCGTCGTGCTGCACGTCGATGTCGGCATCATTCTCTTCCCCGTCTGCCGCACCCTCATCTCGCTCCTGCGC
CAGACGCCGCTCAACGGCATCATCCAGTTCGACAAGAACATCACCTTTCACATCACGACGGCCTGGTCCATCGTC
TTCTGGTCCTGGGTTCACACCATCGCGCACTGGAACAACTTCGCCCAGGTGGCGGCCAAGAACCGGCTCGGCTTC
TACGGCTGGCTGCTCGCCAACTTCGCCTCGGGCCCCGGATGGACGGGCTACGTCATGCTCGTCGCCCTCATGGGC
ATGGTGGTGACGTCGATCGAGAAGCCGCGCCGGGCCAACTACGAGCGCTTCTGGTACACGCACCACATGTTCATC
CTCTTCTTTTTCTTCTGGTCCCTGCACGGCGCCTTCTGCATGATCCAGCCGGACGTGGCGCCCTTCTGCACCAGC
ATCGGCGCCTCGGCCATCGGCGTCTTCTGGCAGTACTGGATGTACGGCGGCTTCGTCTACCTGGCCGAGCGGGTG
GCGCGCGAGCTGCGCGGCCGGCACAAGACGTACATCTCCAAGGTGATCCAGCACCCGAGCCAGGTGTGCGAGATC
CAGATCAAGAAGGAGCACACCAAGACGCGCGCGGGCCAGTACATCTTCTTCTGCTGCCCGGCCGTGTCGCTGTGG
CAGTACCACCCGTTCACGCTGACGAGCGCGCCCGAGGAGGACTACATCTCGATCCACATGCGCTGCCAGGGCGAC
TTCACCATGGCCGTCTCGGCCGCCCTCGGCTGCGAGTGGGCCGGCTGCAAGAAGAACGGGACCGACGCGAGCAAG
GTGGTGGGCGTGGACGAGGACAACGGCGCCGTCGACCCGGTGCTGCGGCGGCTGCTGCCGCGCGTCTACATCGAC
GGGCCCTTTGGCTCGGCGTCGGAGGACGTGTTCAAGTACGAGGTGTCGGTACTGGTGGGCGCCGGCATCGGCGTG
ACGCCCTTTGCGTCGATCCTCAAGTCGATCTGGTACCGGATGAACTACCCGCAGAAGAAGACGCGGCTGTCCAAG
GTCTACTTCTTCTGGATCTGCCGCGACTTCGGCTCCTTCGAGTGGTTCCGCTCGCTGCTGCTGGCCGTCGAGGCG
CAGGACGTCGAGCACCGCATCGAGATCCACACGTACCTGACGGCCAAGATCAAGTCGGACGACGCGACCAACATC
ATGATCAACGACGCCAACGCCGACAAGGACACCATCACGGGGCTGCGGAGCCCGACCAACTTTGGCCGGCCCAAC
TGGGACATGATCTTCCGGAGCATCCGGAAGCTGCACTCGCCGGGCGAGGCCGGCGTCTTCTTCTGCGGGCCCAAG
GGCCTGGGCAGCTCGCTGCACGTGTACTGCAACAAGTACACGGAGCCCGGCTTCTCGTTTGTCTGGGGCAAGGAG
AACTTTTAG
Gene >Hirsu2|2886
ATGGAATACTACGACTACGACTACGCCGGCTACGACCGGCCCTCGGAGCGGTCGAGATGGTCCCCGCTCACCCGC
ATGCTGCTGTCGGGCGAGATGACGCAGGAGAAACAGCAGGTGCTGTCGACGAGAGAACGGTTTGACCGATGGATG
ATCAACGAGGGCTACCGAAGATTGTGAGTCGGACCCCTCGCGAGACGGCGGGACAAGAGGCGAGGCGCGGGCAGG
ACAAGAGCTAACCACCACCCCCCGGCCAGCTTCGTCTTCCTCTTCATGCTGGCGCACGCCCTCATCTTCGCATTC
GCCTCGGTCCACTACGCCGTCAAGGACAGCCTGCAAAGCGCGCGAGACATCTTCGGCTTCACCTACGTCATCGCC
CGCGCGTCGGCCGTCGTGCTGCACGTCGATGTCGGCATCATTCTCTTCCCCGTCTGCCGCACCCTCATCTCGCTC
CTGCGCCAGACGCCGCTCAACGGCATCATCCAGTTCGACAAGAACATCACCTTTCACATCACGACGGCCTGGTCC
ATCGTCTTCTGGTCCTGGGTTCACACCATCGCGCACTGGAACAACTTCGCCCAGGTGGCGGCCAAGAACCGGCTC
GGCTTCTACGGCTGGCTGCTCGCCAACTTCGCCTCGGGCCCCGGATGGACGGGCTACGTCATGCTCGTCGCCCTC
ATGGGCATGGTGGTGACGTCGATCGAGAAGCCGCGCCGGGCCAACTACGAGCGCTTCTGGTACACGCACCACATG
TTCATCCTCTTCTTTTTCTTCTGGTCCCTGCACGGCGCCTTCTGCATGATCCAGCCGGACGTGGCGCCCTTCTGC
ACCAGCATCGGCGCCTCGGCCATCGGCGTCTTCTGGCAGTACTGGATGTACGGCGGCTTCGTCTACCTGGCCGAG
CGGGTGGCGCGCGAGCTGCGCGGCCGGCACAAGACGTACATCTCCAAGGTGATCCAGCACCCGAGCCAGGTGTGC
GAGATCCAGATCAAGAAGGAGCACACCAAGACGCGCGCGGGCCAGTACATCTTCTTCTGCTGCCCGGCCGTGTCG
CTGTGGCAGTACCACCCGTTCACGCTGACGAGCGCGCCCGAGGAGGACTACATCTCGATCCACATGCGCTGCCAG
GGCGACTTCACCATGGCCGTCTCGGCCGCCCTCGGCTGCGAGTGGGCCGGCTGCAAGAAGAACGGGACCGACGCG
AGCAAGGTGGTGGGCGTGGACGAGGACAACGGCGCCGTCGACCCGGTGCTGCGGCGGCTGCTGCCGCGCGTCTAC
ATCGACGGGCCCTTTGGCTCGGCGTCGGAGGACGTGTTCAAGTACGAGGTGTCGGTACTGGTGGGCGCCGGCATC
GGCGTGACGCCCTTTGCGTCGATCCTCAAGTCGATCTGGTACCGGATGAACTACCCGCAGAAGAAGACGCGGCTG
TCCAAGGTCTACTTCTTCTGGATCTGCCGCGACTTCGGCTCCTTCGAGTGGTTCCGCTCGCTGCTGCTGGCCGTC
GAGGCGCAGGACGTCGAGCACCGCATCGAGATCCACACGTACCTGACGGCCAAGATCAAGTCGGACGACGCGACC
AACATCATGATCAACGACGCCAACGCCGACAAGGACACCATCACGGGGCTGCGGAGCCCGACCAACTTTGGCCGG
CCCAACTGGGACATGATCTTCCGGAGCATCCGGAAGCTGCACTCGCCGGGCGAGGCCGGCGTCTTCTTCTGCGGG
CCCAAGGGCCTGGGCAGCTCGCTGCACGTGTACTGCAACAAGTACACGGAGCCCGGGTACGTCTCTCTCTCTCTC
TCTCTCCCCGTCTCCGTCTCCGTCTCTCTCTCCCTCTCTCCCTCTGCCTCTACCACTCTGCCTGCCTCTTTCTCT
CCGGTCTCCTCCCCCACTCTCATCTTTCATCGACTTGCGCAGACGACGACCGGCTAACATTGTTATCGTCCAGCT
TCTCGTTTGTCTGGGGCAAGGAGAACTTTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail