Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2878
Gene name
LocationContig_171:15600..17242
Strand-
Gene length (bp)1642
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.8E-20 246 384

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 26 405 7.0E-53
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 26 405 3.0E-52
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 91 403 8.0E-33
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 91 403 9.0E-33
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 247 408 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 26 405 7.0E-53
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 26 405 3.0E-52
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 91 403 8.0E-33
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 91 403 9.0E-33
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 247 408 4.0E-19
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 247 408 3.0E-18
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 247 408 4.0E-15
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 230 391 6.0E-14
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 92 411 4.0E-13
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 54 385 8.0E-12
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 217 394 8.0E-12
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 247 406 1.0E-11
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 234 406 3.0E-11
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 95 395 6.0E-11
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 247 406 2.0E-10
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 95 394 2.0E-10
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 245 406 2.0E-10
sp|D5AP78|CRTF_RHOCB Demethylspheroidene O-methyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtF PE=1 SV=1 233 409 3.0E-10
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 247 394 2.0E-09
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 83 383 3.0E-09
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 247 406 3.0E-09
sp|Q06528|DNRK_STRPE Carminomycin 4-O-methyltransferase DnrK OS=Streptomyces peucetius GN=dnrK PE=1 SV=2 96 394 2.0E-08
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 247 394 2.0E-08
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 243 384 4.0E-08
sp|Q55216|DNRK_STRS5 Carminomycin 4-O-methyltransferase DauK OS=Streptomyces sp. (strain C5) GN=dauK PE=1 SV=1 96 394 1.0E-07
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 247 394 2.0E-07
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 247 384 2.0E-07
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 230 351 2.0E-07
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 247 399 3.0E-07
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 247 382 6.0E-07
sp|A9X7L0|ANMT_RUTGR Anthranilate N-methyltransferase OS=Ruta graveolens PE=1 SV=1 247 390 1.0E-06
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 230 382 2.0E-06
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 265 394 3.0E-06
sp|B1P123|BX7_MAIZE TRIBOA-glucoside O-methyltransferase BX7 OS=Zea mays GN=BX7 PE=1 SV=1 247 399 8.0E-06
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 247 390 9.0E-06
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 246 390 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7323 0.4019 0.0426 0.0539 0.0843 0.0321 0.2421 0.3027 0.2875 0.0362

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2878
MILDMDSTIALAPGGLEALPGLLSDLAKGVDDLLRGNDADRHDLVHKCRSLMLGLQTPREVMLDHCWAQNGAIAA
ITFGIDSGLWKLMARNGDVPQKVAELAPALGIDPKLLNRLMRHLSSLAYLTQVGADEYLPTNYSRALSLPFMGHG
YLGILASTHLAATEFYQFSRRRGWKNPTDASDTSLMHAYKTDQDLFEFLQSTGHARHFDDFMMGYQLGSPSWMDP
ALFPVQERLIDGADPRPESAFLVDIGGNVGRYLAEFRRRFPHAPGKLILQDLARVLDHAGDLDESIVRMEHNFHH
EQPVKGARAYYMHWILHDWPDAVCESILARTKEAMKPGYSRLLIDEAVVPATGAHWETTGLDMTMLTLLSSAERT
RAEWHELLEVKAGLRIVKIWTRRGRDESVIECERPC*
Coding >Hirsu2|2878
ATGATCCTGGATATGGACTCGACCATTGCCCTGGCGCCGGGGGGCCTTGAAGCGCTCCCGGGCCTCCTGTCGGAT
CTTGCAAAGGGTGTTGACGATCTGCTTCGCGGCAACGACGCCGATCGTCACGATCTGGTCCACAAATGCCGCTCT
TTGATGCTGGGGCTACAGACCCCCCGAGAGGTGATGCTGGACCACTGCTGGGCCCAGAACGGCGCGATTGCTGCC
ATCACCTTTGGCATCGATTCCGGTCTCTGGAAGTTGATGGCCCGCAACGGTGACGTCCCTCAGAAGGTTGCCGAG
CTGGCGCCGGCTCTGGGGATTGATCCGAAGTTGTTGAATCGACTAATGCGCCACCTCAGCTCCTTGGCCTACCTG
ACTCAGGTGGGCGCGGACGAGTATCTGCCGACCAACTATTCCAGGGCCCTGAGTCTCCCCTTCATGGGTCACGGA
TATCTTGGCATCCTGGCGAGCACCCATCTCGCCGCGACCGAATTTTACCAATTCTCCCGGCGGCGAGGCTGGAAG
AACCCGACGGACGCGTCGGACACGTCGTTGATGCACGCCTACAAGACGGACCAGGACCTGTTTGAGTTCCTGCAG
AGCACGGGGCACGCCAGGCACTTCGACGACTTCATGATGGGCTATCAGCTCGGCAGCCCGTCCTGGATGGACCCA
GCCCTGTTCCCGGTCCAGGAGCGGCTCATCGACGGGGCCGACCCGCGGCCCGAGTCGGCCTTCCTGGTGGACATT
GGCGGCAACGTAGGCCGGTACCTGGCCGAGTTCAGGCGGCGCTTCCCCCACGCCCCGGGCAAGCTGATCCTGCAG
GACCTGGCCCGGGTGCTCGACCACGCCGGCGACTTGGACGAGTCCATCGTGCGAATGGAGCACAACTTCCACCAC
GAACAGCCTGTCAAGGGTGCTCGCGCGTACTACATGCACTGGATCCTCCACGACTGGCCCGACGCCGTGTGCGAG
AGCATCCTGGCACGGACCAAGGAGGCCATGAAGCCGGGCTACAGCAGGCTGCTGATCGACGAAGCCGTCGTGCCG
GCCACGGGCGCGCACTGGGAGACGACGGGCCTCGACATGACGATGCTGACGCTGCTGTCGTCGGCGGAGCGGACG
CGGGCGGAGTGGCACGAGCTGCTGGAGGTCAAGGCCGGGCTGAGGATTGTCAAGATCTGGACGAGGCGCGGGCGC
GACGAGAGCGTCATCGAGTGCGAGCGGCCGTGCTGA
Transcript >Hirsu2|2878
ATGATCCTGGATATGGACTCGACCATTGCCCTGGCGCCGGGGGGCCTTGAAGCGCTCCCGGGCCTCCTGTCGGAT
CTTGCAAAGGGTGTTGACGATCTGCTTCGCGGCAACGACGCCGATCGTCACGATCTGGTCCACAAATGCCGCTCT
TTGATGCTGGGGCTACAGACCCCCCGAGAGGTGATGCTGGACCACTGCTGGGCCCAGAACGGCGCGATTGCTGCC
ATCACCTTTGGCATCGATTCCGGTCTCTGGAAGTTGATGGCCCGCAACGGTGACGTCCCTCAGAAGGTTGCCGAG
CTGGCGCCGGCTCTGGGGATTGATCCGAAGTTGTTGAATCGACTAATGCGCCACCTCAGCTCCTTGGCCTACCTG
ACTCAGGTGGGCGCGGACGAGTATCTGCCGACCAACTATTCCAGGGCCCTGAGTCTCCCCTTCATGGGTCACGGA
TATCTTGGCATCCTGGCGAGCACCCATCTCGCCGCGACCGAATTTTACCAATTCTCCCGGCGGCGAGGCTGGAAG
AACCCGACGGACGCGTCGGACACGTCGTTGATGCACGCCTACAAGACGGACCAGGACCTGTTTGAGTTCCTGCAG
AGCACGGGGCACGCCAGGCACTTCGACGACTTCATGATGGGCTATCAGCTCGGCAGCCCGTCCTGGATGGACCCA
GCCCTGTTCCCGGTCCAGGAGCGGCTCATCGACGGGGCCGACCCGCGGCCCGAGTCGGCCTTCCTGGTGGACATT
GGCGGCAACGTAGGCCGGTACCTGGCCGAGTTCAGGCGGCGCTTCCCCCACGCCCCGGGCAAGCTGATCCTGCAG
GACCTGGCCCGGGTGCTCGACCACGCCGGCGACTTGGACGAGTCCATCGTGCGAATGGAGCACAACTTCCACCAC
GAACAGCCTGTCAAGGGTGCTCGCGCGTACTACATGCACTGGATCCTCCACGACTGGCCCGACGCCGTGTGCGAG
AGCATCCTGGCACGGACCAAGGAGGCCATGAAGCCGGGCTACAGCAGGCTGCTGATCGACGAAGCCGTCGTGCCG
GCCACGGGCGCGCACTGGGAGACGACGGGCCTCGACATGACGATGCTGACGCTGCTGTCGTCGGCGGAGCGGACG
CGGGCGGAGTGGCACGAGCTGCTGGAGGTCAAGGCCGGGCTGAGGATTGTCAAGATCTGGACGAGGCGCGGGCGC
GACGAGAGCGTCATCGAGTGCGAGCGGCCGTGCTGA
Gene >Hirsu2|2878
ATGATCCTGGATATGGACTCGACCATTGCCCTGGCGCCGGGGGGCCTTGAAGCGCTCCCGGGCCTCCTGTCGGAT
CTTGCAAAGGGTGTTGACGATCTGCTTCGCGGCAACGACGCCGATCGTCACGATCTGGTCCACAAATGCCGCTCT
TTGATGCTGGGGCTACAGACCCCCCGAGAGGTGATGCTGGACCACTGCTGGGCCCAGGTGAGCATCACGTTGTCG
GATGGGGTGCAGAGAGCGCTCGGCTGATCAACAAGAACGGCGCGATTGCTGCCATCACCTTTGGCATCGATTCCG
GTCTCTGGAAGTTGATGGCCCGCAACGGTGACGTCCCTCAGAAGGTTGCCGAGCTGGCGCCGGCTCTGGGGATTG
ATCCGAAGTTGTTGAGTAGGTGAAGAAATGGGGCCTTGCATGGGCTCTTCGGGCTTTTCCGTGTCCCGTTCTCCC
GGTTCAGATGGGTCGATGAACTGACGTATAGACGTGTAGATCGACTAATGCGCCACCTCAGCTCCTTGGCCTACC
TGACTCAGGTGGGCGCGGACGAGTATCTGCCGACCAACTATTCCAGGGCCCTGAGTCTCCCCTTCATGGGTCACG
GATATCTTGGCATGTAAGCAGATGGTCGATACGACGCTGGGATCTTGGTCCGCGGCAGCCGTTGCCGAGCGCCGG
GGTGCGATGCTGACGCTTGACAACGATGGGCCATTCGTGGCAGCCTGGCGAGCACCCATCTCGCCGCGACCGAAT
TTTACCAATTCTCCCGGCGGCGAGGCTGGAAGAACCCGACGGACGCGTCGGACACGTCGTTGATGCACGCCTACA
AGACGGACCAGGACCTGTTTGAGTTCCTGCAGAGCACGGGGCACGCCAGGCACTTCGACGACTTCATGATGGGCT
ATCAGCTCGGCAGCCCGTCCTGGATGGACCCAGCCCTGTTCCCGGTCCAGGAGCGGCTCATCGACGGGGCCGACC
CGCGGCCCGAGTCGGCCTTCCTGGTGGACATTGGCGGCAACGTAGGCCGGTACCTGGCCGAGTTCAGGCGGCGCT
TCCCCCACGCCCCGGGCAAGCTGATCCTGCAGGACCTGGCCCGGGTGCTCGACCACGCCGGCGACTTGGACGAGT
CCATCGTGCGAATGGAGCACAACTTCCACCACGAACAGCCTGTCAAGGGTGAGTTGCGACGAGTCTGCTGCCTCC
AAAGCCGGCGAGACGGCGAGGCGAGGGCCAGGGCGTTACCGTGCCGTTGCTTCGGCGCGGGATTATTGGCATTGG
CCGCTCACACATATATATGCTAATGTATGTACAACGGGTTCATGCAGGTGCTCGCGCGTACTACATGCACTGGAT
CCTCCACGACTGGCCCGACGCCGTGTGCGAGAGCATCCTGGCACGGACCAAGGAGGCCATGAAGCCGGGCTACAG
CAGGCTGCTGATCGACGAAGCCGTCGTGCCGGCCACGGGCGCGCACTGGGAGACGACGGGCCTCGACATGACGAT
GCTGACGCTGCTGTCGTCGGCGGAGCGGACGCGGGCGGAGTGGCACGAGCTGCTGGAGGTCAAGGCCGGGCTGAG
GATTGTCAAGATCTGGACGAGGCGCGGGCGCGACGAGAGCGTCATCGAGTGCGAGCGGCCGTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail