Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2877
Gene name
LocationContig_171:13008..14949
Strand-
Gene length (bp)1941
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14599 zinc_ribbon_6 Zinc-ribbon 1.0E-25 426 482
PF05495 zf-CHY CHY zinc finger 8.0E-19 250 323
PF13639 zf-RING_2 Ring finger domain 1.6E-07 378 421
PF14634 zf-RING_5 zinc-RING finger domain 1.4E-06 379 422

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14099|YERG_SCHPO Uncharacterized RING finger protein C2F3.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.16 PE=3 SV=1 248 482 3.0E-87
sp|Q9CR50|ZN363_MOUSE RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1 247 484 7.0E-64
sp|Q96PM5|ZN363_HUMAN RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1 249 484 2.0E-63
sp|Q8VZK0|MIEL1_ARATH E3 ubiquitin-protein ligase MIEL1 OS=Arabidopsis thaliana GN=MIEL1 PE=1 SV=1 248 482 4.0E-56

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2877
MSSLVSEFLINPVLRQARRLSEISRSTFAGDEEHASSPPPSAAAVSDPGHADSDHGPVEQEAVAEPPHTPRSRPL
STASTVETRVGDVASSASPPAMAATPPARDHLGFPASPSRARGIPEDDGKGELRSRIQAINIQAISMADKARLMH
EAMLEGYHASLRDDARNPGAGADSPAGGQTWEHTPASGPLDSLRFWHGQFGDASAAESFTLSESDIAPTYAPIRQ
PKSPGNSTPTKTPPSPPDVSPPLGCQHYERNVKLQCSTCHKWHTCRFCHDSKEDHTLIRKETKNMLCMLCGTPQR
ASEACIKCNEPAAQYYCNICKLWENRQSRPIYHCNDCGICRRGLGLGKDFFHCKTCRACITTSIQSSHKCIERST
DCDCPICGEYMFTSPKRVVFMSCGHSIHKKCYDQHMKVSYKCPICNKSLANMETQFRNLDVAIQSQPMPPEFRDT
KATVLCNDCSGRSTVSYHWLGLKCSICRSYNTVELHIHGHMFGQVRAASESAEPSAAATPQSSQESTLSTGTSSS
GGSWLSNRRRHSSHDVELQHRVPDRVARSASPPDLVIDPQLAQVAAEMDSEDDILGFWRSSHEDDSDDREDDSDS
DQDGHGGAAGAEDDDDDDEIMLIGHR*
Coding >Hirsu2|2877
ATGTCCTCCCTTGTGTCCGAGTTCCTCATCAACCCCGTCCTGCGCCAGGCCCGCCGCCTTTCCGAGATATCCCGC
TCCACGTTTGCGGGCGACGAAGAGCACGCCAGCAGCCCGCCGCCCTCCGCCGCCGCCGTCAGCGATCCGGGCCAT
GCCGACTCCGACCATGGGCCTGTAGAGCAAGAAGCGGTCGCCGAGCCCCCGCACACGCCGCGCTCTCGCCCCCTC
AGCACCGCATCGACCGTCGAGACCAGAGTCGGCGACGTCGCCTCGTCCGCCAGCCCGCCCGCCATGGCCGCCACG
CCCCCCGCCCGAGACCACCTCGGCTTCCCCGCCTCGCCCAGCAGGGCCCGCGGCATCCCCGAGGACGACGGCAAG
GGCGAGCTGCGCAGCCGCATCCAGGCCATCAACATCCAGGCCATCTCCATGGCCGACAAGGCCAGACTCATGCAC
GAGGCCATGCTCGAGGGCTACCACGCCTCGCTCCGCGACGACGCCAGGAACCCCGGCGCCGGCGCCGACTCGCCC
GCTGGCGGACAGACGTGGGAGCACACGCCCGCCTCGGGCCCCCTCGACTCCCTCCGCTTCTGGCACGGGCAGTTC
GGCGACGCCTCGGCCGCCGAGAGCTTCACCCTATCCGAGAGCGACATCGCCCCGACCTACGCGCCCATCCGCCAG
CCCAAAAGTCCCGGCAACTCCACCCCGACCAAGACGCCGCCCAGCCCGCCCGACGTGAGCCCTCCGCTCGGCTGC
CAACACTACGAACGCAACGTCAAGTTGCAGTGTTCCACCTGCCACAAATGGCACACCTGCCGCTTCTGCCACGAC
AGCAAGGAGGACCACACCCTGATCCGCAAGGAGACCAAGAACATGCTGTGTATGCTCTGCGGCACGCCCCAGAGG
GCCTCCGAGGCCTGCATCAAGTGCAACGAGCCCGCTGCGCAGTACTACTGCAATATATGCAAGCTGTGGGAGAAT
CGGCAGAGCAGGCCCATCTACCACTGCAACGACTGCGGCATCTGTCGACGCGGGCTGGGCCTCGGTAAAGACTTT
TTCCACTGCAAGACCTGCCGCGCCTGCATCACCACCTCCATCCAGAGCTCCCACAAATGCATCGAACGGTCGACC
GACTGCGACTGTCCCATATGCGGAGAGTACATGTTCACGTCGCCCAAGCGCGTCGTCTTCATGAGCTGCGGCCAC
AGCATCCATAAGAAATGCTACGACCAGCACATGAAGGTCTCGTACAAGTGCCCCATCTGCAACAAGAGTCTGGCC
AATATGGAGACGCAGTTCCGCAACCTGGACGTGGCCATCCAGAGCCAGCCGATGCCTCCCGAGTTCCGCGACACC
AAGGCCACCGTGCTCTGCAACGACTGCTCCGGCCGGAGCACTGTGTCCTACCACTGGCTCGGTCTCAAGTGCTCC
ATCTGTCGGTCGTACAATACCGTCGAGCTGCACATACACGGCCATATGTTCGGGCAAGTCCGGGCGGCCTCGGAG
AGTGCGGAACCTTCAGCCGCGGCGACTCCGCAGTCCAGCCAAGAGTCGACGCTGTCGACGGGCACATCCAGCAGT
GGCGGCTCGTGGCTCTCCAACAGACGGCGCCACTCGTCTCATGACGTGGAGCTCCAGCATCGCGTGCCAGACAGG
GTCGCGCGGTCCGCGTCTCCGCCCGACTTGGTCATAGATCCGCAACTCGCACAGGTGGCCGCCGAAATGGATTCC
GAAGACGACATCTTGGGCTTCTGGAGGTCGTCTCACGAGGATGACTCGGACGATCGAGAAGACGATTCCGACTCT
GATCAGGACGGCCACGGCGGGGCGGCGGGCGCAGAAGATGATGACGATGACGACGAAATCATGCTCATCGGGCAT
CGGTGA
Transcript >Hirsu2|2877
ATGTCCTCCCTTGTGTCCGAGTTCCTCATCAACCCCGTCCTGCGCCAGGCCCGCCGCCTTTCCGAGATATCCCGC
TCCACGTTTGCGGGCGACGAAGAGCACGCCAGCAGCCCGCCGCCCTCCGCCGCCGCCGTCAGCGATCCGGGCCAT
GCCGACTCCGACCATGGGCCTGTAGAGCAAGAAGCGGTCGCCGAGCCCCCGCACACGCCGCGCTCTCGCCCCCTC
AGCACCGCATCGACCGTCGAGACCAGAGTCGGCGACGTCGCCTCGTCCGCCAGCCCGCCCGCCATGGCCGCCACG
CCCCCCGCCCGAGACCACCTCGGCTTCCCCGCCTCGCCCAGCAGGGCCCGCGGCATCCCCGAGGACGACGGCAAG
GGCGAGCTGCGCAGCCGCATCCAGGCCATCAACATCCAGGCCATCTCCATGGCCGACAAGGCCAGACTCATGCAC
GAGGCCATGCTCGAGGGCTACCACGCCTCGCTCCGCGACGACGCCAGGAACCCCGGCGCCGGCGCCGACTCGCCC
GCTGGCGGACAGACGTGGGAGCACACGCCCGCCTCGGGCCCCCTCGACTCCCTCCGCTTCTGGCACGGGCAGTTC
GGCGACGCCTCGGCCGCCGAGAGCTTCACCCTATCCGAGAGCGACATCGCCCCGACCTACGCGCCCATCCGCCAG
CCCAAAAGTCCCGGCAACTCCACCCCGACCAAGACGCCGCCCAGCCCGCCCGACGTGAGCCCTCCGCTCGGCTGC
CAACACTACGAACGCAACGTCAAGTTGCAGTGTTCCACCTGCCACAAATGGCACACCTGCCGCTTCTGCCACGAC
AGCAAGGAGGACCACACCCTGATCCGCAAGGAGACCAAGAACATGCTGTGTATGCTCTGCGGCACGCCCCAGAGG
GCCTCCGAGGCCTGCATCAAGTGCAACGAGCCCGCTGCGCAGTACTACTGCAATATATGCAAGCTGTGGGAGAAT
CGGCAGAGCAGGCCCATCTACCACTGCAACGACTGCGGCATCTGTCGACGCGGGCTGGGCCTCGGTAAAGACTTT
TTCCACTGCAAGACCTGCCGCGCCTGCATCACCACCTCCATCCAGAGCTCCCACAAATGCATCGAACGGTCGACC
GACTGCGACTGTCCCATATGCGGAGAGTACATGTTCACGTCGCCCAAGCGCGTCGTCTTCATGAGCTGCGGCCAC
AGCATCCATAAGAAATGCTACGACCAGCACATGAAGGTCTCGTACAAGTGCCCCATCTGCAACAAGAGTCTGGCC
AATATGGAGACGCAGTTCCGCAACCTGGACGTGGCCATCCAGAGCCAGCCGATGCCTCCCGAGTTCCGCGACACC
AAGGCCACCGTGCTCTGCAACGACTGCTCCGGCCGGAGCACTGTGTCCTACCACTGGCTCGGTCTCAAGTGCTCC
ATCTGTCGGTCGTACAATACCGTCGAGCTGCACATACACGGCCATATGTTCGGGCAAGTCCGGGCGGCCTCGGAG
AGTGCGGAACCTTCAGCCGCGGCGACTCCGCAGTCCAGCCAAGAGTCGACGCTGTCGACGGGCACATCCAGCAGT
GGCGGCTCGTGGCTCTCCAACAGACGGCGCCACTCGTCTCATGACGTGGAGCTCCAGCATCGCGTGCCAGACAGG
GTCGCGCGGTCCGCGTCTCCGCCCGACTTGGTCATAGATCCGCAACTCGCACAGGTGGCCGCCGAAATGGATTCC
GAAGACGACATCTTGGGCTTCTGGAGGTCGTCTCACGAGGATGACTCGGACGATCGAGAAGACGATTCCGACTCT
GATCAGGACGGCCACGGCGGGGCGGCGGGCGCAGAAGATGATGACGATGACGACGAAATCATGCTCATCGGGCAT
CGGTGA
Gene >Hirsu2|2877
ATGTCCTCCCTTGTGTCCGAGTTCCTCATCAACCCCGTCCTGCGCCAGGCCCGCCGCCTTTCCGAGATATCCCGC
TCCACGTTTGCGGGCGACGAAGAGCACGCCAGCAGCCCGCCGCCCTCCGCCGCCGCCGTCAGCGATCCGGGCCAT
GCCGACTCCGACCATGGGCCTGTAGAGCAAGAAGCGGTCGCCGAGCCCCCGCACACGCCGCGCTCTCGCCCCCTC
AGCACCGCATCGACCGTCGAGACCAGAGTCGGCGACGTCGCCTCGTCCGCCAGCCCGCCCGCCATGGCCGCCACG
CCCCCCGCCCGAGACCACCTCGGCTTCCCCGCCTCGCCCAGCAGGGCCCGCGGCATCCCCGAGGACGACGGCAAG
GGCGAGCTGCGCAGCCGCATCCAGGCCATCAACATCCAGGCCATCTCCATGGCCGACAAGGCCAGACTCATGCAC
GAGGCCATGCTCGAGGGCTACCACGCCTCGCTCCGCGACGACGCCAGGAACCCCGGCGCCGGCGCCGACTCGCCC
GCTGGCGGACAGACGTGGGAGCACACGCCCGCCTCGGGCCCCCTCGACTCCCTCCGCTTCTGGCACGGGCAGTTC
GGCGACGCCTCGGCCGCCGAGAGCTTCACCCTATCCGAGAGCGACATCGCCCCGACCTACGCGCCCATCCGCCAG
CCCAAAAGTCCCGGCAACTCCACCCCGACCAAGACGCCGCCCAGCCCGCCCGACGTGAGCCCTCCGCTCGGCTGC
CAACACTACGAACGCAACGTCAAGTTGCAGTGTTCCACCTGCCACAAATGGCACACCTGCCGCTTCTGCCACGAC
AGCAAGGAGGACCACACCCTGATCCGCAAGGAGACCAAGAACATGCTGTGTATGCTCTGCGGCACGCCCCAGAGG
GCCTCCGAGGCCTGCATCAAGTGCAACGAGCCCGCTGCGCAGTACTACTGCAATATATGCAAGCTGTGGGAGAAT
CGGCAGAGCAGGCCCATCTACCACTGCAACGACTGCGGCATCTGTCGACGCGGGCTGGGCCTCGGTAAAGACTTT
TTCCACTGCAAGGTACGTGTTTTGGCCTGTGTCGGCAGGGCCGCAGGAGCCTCGTTCTGACCCAGGCCACAGACC
TGCCGCGCCTGCATCACCACCTCCATCCAGAGCTCCCACAAATGCATCGAACGGTCGACCGACTGCGACTGTCCC
ATATGCGGAGAGTACATGTTCACGTCGCCCAAGCGCGTCGTCTTCATGAGCTGCGGCCACAGCATCCATAAGAAA
TGCTACGACCAGCACATGAAGGTCTCGTACAAGTGCCCCATCTGCAACAAGAGTCTGGCCAATATGGAGACGCAG
TTCCGCAACCTGGACGTGGCCATCCAGAGCCAGCCGATGCCTCCCGAGTTCCGCGACACCAAGGCCACCGTGCTC
TGCAACGACTGCTCCGGCCGGAGCACTGTGTCCTACCACTGGCTCGGTCTCAAGTGCTCCATCTGTCGGTCGTAC
AATACCGTCGAGCTGCACATACACGGCCATATGTTCGGGCAAGTCCGGGCGGCCTCGGAGAGTGCGGAACCTTCA
GCCGCGGCGACTCCGCAGTCCAGCCAAGAGTCGACGCTGTCGACGGGCACATCCAGCAGTGGCGGCTCGTGGCTC
TCCAACAGACGGCGCCACTCGTCTCATGACGTGGAGCTCCAGCATCGCGTGCCAGACAGGGTCGCGCGGTCCGCG
TCTCCGCCCGACTTGGTCATAGATCCGCAACTCGCACAGGTGGCCGCCGAAATGGATTCCGAAGACGACATCTTG
GGCTTCTGGAGGTCGTCTCACGAGGATGACTCGGACGATCGAGAAGACGATTCCGACTCTGATCAGGACGGCCAC
GGCGGGGCGGCGGGCGCAGAAGATGATGACGATGACGACGAAATCATGCTCATCGGGCATCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail