Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2875
Gene name
LocationContig_171:10983..11891
Strand+
Gene length (bp)908
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08234 Spindle_Spc25 Chromosome segregation protein Spc25 1.8E-24 183 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IMM0|SPC25_GIBZE Probable kinetochore protein SPC25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPC25 PE=3 SV=3 1 259 6.0E-150
sp|Q873B7|SPC25_NEUCR Probable kinetochore protein spc25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kpr-4 PE=3 SV=1 1 259 1.0E-145
sp|Q2UPH5|SPC25_ASPOR Probable kinetochore protein spc25 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spc25 PE=3 SV=1 1 258 2.0E-101
sp|Q5BDI8|SPC25_EMENI Probable kinetochore protein spc25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spc25 PE=3 SV=1 3 258 9.0E-96
sp|Q10430|SPC25_SCHPO Kinetochore protein spc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc25 PE=1 SV=1 29 255 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IMM0|SPC25_GIBZE Probable kinetochore protein SPC25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPC25 PE=3 SV=3 1 259 6.0E-150
sp|Q873B7|SPC25_NEUCR Probable kinetochore protein spc25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kpr-4 PE=3 SV=1 1 259 1.0E-145
sp|Q2UPH5|SPC25_ASPOR Probable kinetochore protein spc25 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spc25 PE=3 SV=1 1 258 2.0E-101
sp|Q5BDI8|SPC25_EMENI Probable kinetochore protein spc25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spc25 PE=3 SV=1 3 258 9.0E-96
sp|Q10430|SPC25_SCHPO Kinetochore protein spc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc25 PE=1 SV=1 29 255 3.0E-34
sp|Q6BNN6|SPC25_DEBHA Probable kinetochore protein SPC25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPC25 PE=3 SV=2 37 257 2.0E-16
sp|Q6CGV4|SPC25_YARLI Probable kinetochore protein SPC25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC25 PE=3 SV=1 109 257 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2875
MATAFEPSLSASLTARQSLAPVGPSAADSLPSINFGFDDLRERLAKFSVKFDAFIEQGRKRVLEERNQFRMNVAE
LQEDERMKKKEMEIAQVKTATYQQTLAKEEAETREMEAAIASIAAQRDNQLARRDGLRQQIAQTEAEIEARLAAQ
RAFAAQQEAQSRFNVPELDFWITNLCLKIEGAGHDDRLKFIYTHLDERNWEREAWFELVTSSRDYDVLHCRPKLE
RDRVERVLERVNESRELVVLLKGMRELFVEAMKS*
Coding >Hirsu2|2875
ATGGCGACCGCTTTCGAGCCGTCGCTGTCGGCGAGCCTCACCGCCCGCCAGTCCCTGGCGCCCGTCGGCCCGTCG
GCCGCCGACTCGCTGCCCAGCATCAACTTCGGCTTCGACGACCTGCGCGAGCGCCTGGCCAAGTTCAGCGTCAAG
TTCGACGCCTTCATCGAGCAGGGCCGCAAGCGCGTCCTGGAAGAGCGCAACCAGTTCCGCATGAACGTGGCCGAG
CTGCAAGAGGACGAGCGGATGAAGAAGAAGGAGATGGAGATCGCGCAGGTCAAGACGGCGACGTACCAGCAGACG
CTGGCCAAGGAGGAGGCGGAGACGCGCGAGATGGAGGCGGCCATCGCGTCGATCGCGGCGCAGCGCGACAACCAG
CTGGCGCGGCGCGACGGGCTGCGGCAGCAGATCGCGCAGACGGAGGCGGAGATCGAGGCGCGGCTGGCGGCGCAG
CGGGCCTTCGCGGCGCAGCAGGAGGCACAGTCGCGCTTCAACGTGCCCGAGCTCGACTTCTGGATCACGAACCTG
TGCCTCAAGATCGAGGGCGCCGGCCACGACGACCGGCTCAAGTTCATCTACACCCACCTCGACGAGCGCAACTGG
GAGCGCGAGGCCTGGTTCGAGCTCGTCACCAGCTCGCGCGACTACGACGTCCTGCACTGCCGGCCCAAGCTGGAG
CGCGACCGGGTCGAGCGCGTGCTGGAGCGGGTCAACGAGTCGAGGGAGCTGGTGGTGCTGCTCAAGGGGATGAGG
GAGCTGTTTGTCGAGGCCATGAAGTCTTGA
Transcript >Hirsu2|2875
ATGGCGACCGCTTTCGAGCCGTCGCTGTCGGCGAGCCTCACCGCCCGCCAGTCCCTGGCGCCCGTCGGCCCGTCG
GCCGCCGACTCGCTGCCCAGCATCAACTTCGGCTTCGACGACCTGCGCGAGCGCCTGGCCAAGTTCAGCGTCAAG
TTCGACGCCTTCATCGAGCAGGGCCGCAAGCGCGTCCTGGAAGAGCGCAACCAGTTCCGCATGAACGTGGCCGAG
CTGCAAGAGGACGAGCGGATGAAGAAGAAGGAGATGGAGATCGCGCAGGTCAAGACGGCGACGTACCAGCAGACG
CTGGCCAAGGAGGAGGCGGAGACGCGCGAGATGGAGGCGGCCATCGCGTCGATCGCGGCGCAGCGCGACAACCAG
CTGGCGCGGCGCGACGGGCTGCGGCAGCAGATCGCGCAGACGGAGGCGGAGATCGAGGCGCGGCTGGCGGCGCAG
CGGGCCTTCGCGGCGCAGCAGGAGGCACAGTCGCGCTTCAACGTGCCCGAGCTCGACTTCTGGATCACGAACCTG
TGCCTCAAGATCGAGGGCGCCGGCCACGACGACCGGCTCAAGTTCATCTACACCCACCTCGACGAGCGCAACTGG
GAGCGCGAGGCCTGGTTCGAGCTCGTCACCAGCTCGCGCGACTACGACGTCCTGCACTGCCGGCCCAAGCTGGAG
CGCGACCGGGTCGAGCGCGTGCTGGAGCGGGTCAACGAGTCGAGGGAGCTGGTGGTGCTGCTCAAGGGGATGAGG
GAGCTGTTTGTCGAGGCCATGAAGTCTTGA
Gene >Hirsu2|2875
ATGGCGACCGCTTTCGAGCCGTCGCTGTCGGCGAGCCTCACCGCCCGCCAGTCCCTGGCGCCCGTCGGCCCGTCG
GCCGCCGACTCGCTGCCCAGCATCAACTTCGGCTTCGACGACCTGCGCGAGCGCCTGGCCAAGTTCAGCGTCAAG
TTCGACGCCTTCATCGAGCAGGGCCGCAAGCGCGTCCTGGAAGAGCGCAACCAGTTCCGCATGAACGTGGCCGAG
CTGCAAGGTACGAAGGAAGAACGGCCACTTCCCCTCGTCCGAGGCAGCACGAGGGGGCGGGACGGGGGCAGCGTG
GGAAGGGGAAGCAGTGTGCGTGATTCGCTAACGACGGAGGGCCGCCTCGCCACGCTACAGAGGACGAGCGGATGA
AGAAGAAGGAGATGGAGATCGCGCAGGTCAAGACGGCGACGTACCAGCAGACGCTGGCCAAGGAGGAGGCGGAGA
CGCGCGAGATGGAGGCGGCCATCGCGTCGATCGCGGCGCAGCGCGACAACCAGCTGGCGCGGCGCGACGGGCTGC
GGCAGCAGATCGCGCAGACGGAGGCGGAGATCGAGGCGCGGCTGGCGGCGCAGCGGGCCTTCGCGGCGCAGCAGG
AGGCACAGTCGCGCTTCAACGTGCCCGAGCTCGACTTCTGGATCACGAACCTGTGCCTCAAGATCGAGGGCGCCG
GCCACGACGACCGGCTCAAGTTCATCTACACCCACCTCGACGAGCGCAACTGGGAGCGCGAGGCCTGGTTCGAGC
TCGTCACCAGCTCGCGCGACTACGACGTCCTGCACTGCCGGCCCAAGCTGGAGCGCGACCGGGTCGAGCGCGTGC
TGGAGCGGGTCAACGAGTCGAGGGAGCTGGTGGTGCTGCTCAAGGGGATGAGGGAGCTGTTTGTCGAGGCCATGA
AGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail