Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2871
Gene name
LocationContig_171:68..694
Strand+
Gene length (bp)626
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08695 Coa1 Cytochrome oxidase complex assembly protein 1 1.6E-36 21 137

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40452|COA1_YEAST Cytochrome c oxidase assembly factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA1 PE=1 SV=1 4 144 7.0E-22
sp|O14320|COA1_SCHPO Cytochrome c oxidase assembly factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coa1 PE=3 SV=1 2 142 8.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 19 38 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2871
MTRRADRELPDIQQVGFRWWRTLPLFVGLVAASALAIFNYQKTTSPIVASTLYALRTSPRARARLGDDIYFRRAV
PWIAGEMNQLRGRVDVRFGVRGSAGAATMRFVSRRPGPRALFETLEWSLTMDDDGEWVDLLEGAGADPFRALLAD
DDEPPPLGAPPGTPPHEAPSTRGFRQQGALNK*
Coding >Hirsu2|2871
ATGACGCGGCGGGCCGACCGCGAGCTCCCAGACATCCAGCAGGTCGGCTTCCGCTGGTGGCGCACGCTGCCGCTC
TTCGTCGGGCTGGTGGCGGCGTCGGCGCTGGCCATCTTCAACTACCAGAAGACGACGTCGCCGATCGTGGCGTCG
ACGCTGTACGCGCTGCGGACGTCGCCGCGGGCGCGCGCCCGCCTCGGCGACGACATCTACTTCCGCCGCGCCGTG
CCGTGGATCGCGGGCGAGATGAACCAGCTGCGCGGCCGCGTCGACGTCCGCTTCGGCGTCCGCGGCTCCGCCGGC
GCCGCTACCATGCGCTTCGTCAGCCGCCGCCCGGGCCCGCGCGCGCTCTTCGAGACGCTCGAGTGGAGCCTGACC
ATGGACGACGACGGCGAGTGGGTCGACCTGCTTGAGGGCGCCGGCGCCGACCCCTTCCGTGCCCTGCTCGCCGAC
GACGACGAGCCGCCGCCGCTCGGGGCGCCGCCCGGGACGCCGCCGCACGAGGCTCCATCCACCAGGGGTTTCAGG
CAGCAGGGCGCCCTGAACAAGTGA
Transcript >Hirsu2|2871
ATGACGCGGCGGGCCGACCGCGAGCTCCCAGACATCCAGCAGGTCGGCTTCCGCTGGTGGCGCACGCTGCCGCTC
TTCGTCGGGCTGGTGGCGGCGTCGGCGCTGGCCATCTTCAACTACCAGAAGACGACGTCGCCGATCGTGGCGTCG
ACGCTGTACGCGCTGCGGACGTCGCCGCGGGCGCGCGCCCGCCTCGGCGACGACATCTACTTCCGCCGCGCCGTG
CCGTGGATCGCGGGCGAGATGAACCAGCTGCGCGGCCGCGTCGACGTCCGCTTCGGCGTCCGCGGCTCCGCCGGC
GCCGCTACCATGCGCTTCGTCAGCCGCCGCCCGGGCCCGCGCGCGCTCTTCGAGACGCTCGAGTGGAGCCTGACC
ATGGACGACGACGGCGAGTGGGTCGACCTGCTTGAGGGCGCCGGCGCCGACCCCTTCCGTGCCCTGCTCGCCGAC
GACGACGAGCCGCCGCCGCTCGGGGCGCCGCCCGGGACGCCGCCGCACGAGGCTCCATCCACCAGGGGTTTCAGG
CAGCAGGGCGCCCTGAACAAGTGA
Gene >Hirsu2|2871
ATGACGCGGCGGGCCGACCGCGAGCTCCCAGGTGAGCGCTCCCCGAATCCCCCCCTCCCCAAGAAAAGGAGGTGA
GGGGGGGGAAAGAGGCTGACGGAGCAGGAGCAGACATCCAGCAGGTCGGCTTCCGCTGGTGGCGCACGCTGCCGC
TCTTCGTCGGGCTGGTGGCGGCGTCGGCGCTGGCCATCTTCAACTACCAGAAGACGACGTCGCCGATCGTGGCGT
CGACGCTGTACGCGCTGCGGACGTCGCCGCGGGCGCGCGCCCGCCTCGGCGACGACATCTACTTCCGCCGCGCCG
TGCCGTGGATCGCGGGCGAGATGAACCAGCTGCGCGGCCGCGTCGACGTCCGCTTCGGCGTCCGCGGCTCCGCCG
GCGCCGCTACCATGCGCTTCGTCAGCCGCCGCCCGGGCCCGCGCGCGCTCTTCGAGACGCTCGAGTGGAGCCTGA
CCATGGACGACGACGGCGAGTGGGTCGACCTGCTTGAGGGCGCCGGCGCCGACCCCTTCCGTGCCCTGCTCGCCG
ACGACGACGAGCCGCCGCCGCTCGGGGCGCCGCCCGGGACGCCGCCGCACGAGGCTCCATCCACCAGGGGTTTCA
GGCAGCAGGGCGCCCTGAACAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail