Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2856
Gene name
LocationContig_1703:2047..3212
Strand-
Gene length (bp)1165
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 3.7E-19 145 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14118|EFM3_SCHPO Protein-lysine N-methyltransferase efm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.03 PE=3 SV=3 127 298 8.0E-24
sp|P47163|EFM3_YEAST Protein-lysine N-methyltransferase EFM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM3 PE=1 SV=2 30 310 9.0E-22
sp|Q96G04|EF2KT_HUMAN Protein-lysine N-methyltransferase EEF2KMT OS=Homo sapiens GN=EEF2KMT PE=1 SV=2 129 335 9.0E-18
sp|Q8N7N1|F86B1_HUMAN Putative protein N-methyltransferase FAM86B1 OS=Homo sapiens GN=FAM86B1 PE=2 SV=2 112 307 3.0E-15
sp|Q1JPJ9|EF2KT_BOVIN Protein-lysine N-methyltransferase EEF2KMT OS=Bos taurus GN=EEF2KMT PE=2 SV=2 58 335 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14118|EFM3_SCHPO Protein-lysine N-methyltransferase efm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.03 PE=3 SV=3 127 298 8.0E-24
sp|P47163|EFM3_YEAST Protein-lysine N-methyltransferase EFM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM3 PE=1 SV=2 30 310 9.0E-22
sp|Q96G04|EF2KT_HUMAN Protein-lysine N-methyltransferase EEF2KMT OS=Homo sapiens GN=EEF2KMT PE=1 SV=2 129 335 9.0E-18
sp|Q8N7N1|F86B1_HUMAN Putative protein N-methyltransferase FAM86B1 OS=Homo sapiens GN=FAM86B1 PE=2 SV=2 112 307 3.0E-15
sp|Q1JPJ9|EF2KT_BOVIN Protein-lysine N-methyltransferase EEF2KMT OS=Bos taurus GN=EEF2KMT PE=2 SV=2 58 335 5.0E-15
sp|P0C5J1|F86B2_HUMAN Putative protein N-methyltransferase FAM86B2 OS=Homo sapiens GN=FAM86B2 PE=1 SV=1 135 307 1.0E-14
sp|Q3UZW7|EF2KT_MOUSE Protein-lysine N-methyltransferase EEF2KMT OS=Mus musculus GN=Eef2kmt PE=1 SV=1 115 336 1.0E-14
sp|Q86JB0|Y8324_DICDI Putative uncharacterized protein DDB_G0277003 OS=Dictyostelium discoideum GN=DDB_G0277003 PE=4 SV=2 140 310 7.0E-14
sp|A4FV98|MT21B_BOVIN Protein-lysine methyltransferase METTL21B OS=Bos taurus GN=METTL21B PE=2 SV=1 148 297 3.0E-13
sp|Q96AZ1|MT21B_HUMAN Protein-lysine methyltransferase METTL21B OS=Homo sapiens GN=METTL21B PE=1 SV=1 148 297 2.0E-10
sp|Q9UT28|NNT1_SCHPO Protein N-methyltransferase nnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nnt1 PE=3 SV=1 150 325 7.0E-10
sp|Q28IN4|MT21B_XENTR Protein-lysine methyltransferase METTL21B OS=Xenopus tropicalis GN=mettl21b PE=2 SV=1 150 297 9.0E-09
sp|P30643|YNE4_CAEEL Uncharacterized protein R08D7.4 OS=Caenorhabditis elegans GN=R08D7.4 PE=4 SV=3 143 295 1.0E-08
sp|A4IGU3|MT21A_XENTR Protein N-lysine methyltransferase METTL21A OS=Xenopus tropicalis GN=mettl21a PE=2 SV=1 149 299 2.0E-08
sp|Q6FJ22|NNT1_CANGA Protein N-methyltransferase NNT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NNT1 PE=3 SV=1 135 309 2.0E-08
sp|Q6DJF8|MET23_XENLA Methyltransferase-like protein 23 OS=Xenopus laevis GN=mettl23 PE=2 SV=1 146 288 9.0E-08
sp|Q05874|NNT1_YEAST Protein N-methyltransferase NNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NNT1 PE=1 SV=1 114 283 3.0E-07
sp|P53970|EFM6_YEAST Protein-lysine N-methyltransferase EFM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM6 PE=1 SV=1 140 310 5.0E-07
sp|Q5BLD8|MT21A_DANRE Protein N-lysine methyltransferase METTL21A OS=Danio rerio GN=mettl21a PE=2 SV=1 167 290 7.0E-07
sp|P0CP44|NNT1_CRYNJ Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NNT1 PE=3 SV=1 138 268 1.0E-06
sp|P0CP45|NNT1_CRYNB Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NNT1 PE=3 SV=1 138 268 1.0E-06
sp|Q9H867|MT21D_HUMAN Protein-lysine methyltransferase METTL21D OS=Homo sapiens GN=VCPKMT PE=1 SV=2 141 276 2.0E-06
sp|Q74ZB5|NNT1_ASHGO Protein N-methyltransferase NNT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NNT1 PE=3 SV=1 130 309 2.0E-06
sp|Q5RJL2|MET23_RAT Methyltransferase-like protein 23 OS=Rattus norvegicus GN=Mettl23 PE=2 SV=1 146 272 6.0E-06
sp|Q8WXB1|MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens GN=METTL21A PE=1 SV=2 150 297 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2856
MVRPLWTPHVDRFCHQCLQLEPAPDYPPAEVLRLAEAQDALYTRLFADRASLSGTPERYRARLLKELVARIEAAI
EDWDEHAVSDDLMSALSLLLGTSLPPESASVRAKCIVTYHLSLLSPGDRWDEPGIRLREKRSLISACGTTGLRTW
EAALHLGQYLCLHPDVVAGKRVLELGAGTGYLSILCAKYLSATHAVVSDGSDEVVDSLTGNFRLNVADSARLSPR
MLRWGRAQPRAQEGDQGQSPVDVVLGADITYDDRAMPALVETIVDLMGLSSGAEVYIAATQRNERTFATFLEVCG
RNGLDVEDITFPVTPREQQRGPFYENQVAIRICRLLRV*
Coding >Hirsu2|2856
ATGGTTCGCCCGTTATGGACACCTCACGTGGATCGCTTCTGTCACCAATGTCTCCAGCTCGAGCCCGCGCCAGAC
TACCCTCCCGCTGAGGTTCTCAGGCTGGCCGAGGCACAAGACGCCCTCTACACAAGGCTCTTTGCAGACAGGGCT
TCGTTATCGGGAACACCCGAACGATACCGGGCACGCTTACTCAAGGAGCTGGTGGCGCGAATCGAGGCCGCAATT
GAAGACTGGGACGAGCATGCGGTATCCGACGACCTCATGTCCGCCCTCTCCCTCCTCCTCGGCACGTCGCTGCCC
CCCGAGTCAGCATCGGTGCGGGCCAAGTGCATCGTCACCTACCACCTGTCGCTGCTCTCCCCCGGGGACCGGTGG
GACGAGCCCGGCATCAGGCTGCGGGAGAAACGGTCCCTCATTTCTGCCTGCGGAACCACCGGACTGCGCACCTGG
GAGGCGGCACTCCACCTCGGGCAGTATCTGTGTCTGCACCCGGACGTCGTGGCTGGGAAGCGCGTCTTGGAGCTC
GGCGCCGGCACGGGCTACCTCTCCATCCTGTGCGCCAAGTATCTGTCTGCGACTCATGCCGTTGTGTCGGACGGA
TCCGACGAGGTCGTTGACAGCCTGACTGGCAACTTTCGCCTCAACGTGGCCGACTCCGCACGCCTCAGCCCCAGG
ATGCTCCGTTGGGGTCGCGCCCAGCCCAGAGCGCAGGAGGGAGACCAAGGGCAGTCTCCTGTTGACGTCGTCCTC
GGGGCCGACATTACCTACGACGACCGGGCGATGCCTGCCCTCGTCGAGACCATTGTCGACCTGATGGGGCTGAGC
AGCGGCGCCGAGGTGTACATTGCCGCTACCCAGCGCAACGAGCGCACCTTTGCGACGTTTCTGGAAGTCTGCGGC
CGCAACGGCCTCGACGTCGAGGACATCACATTTCCCGTCACGCCGAGAGAGCAGCAGCGGGGCCCATTCTACGAG
AACCAAGTCGCCATCCGCATTTGCCGCCTCCTAAGAGTCTAA
Transcript >Hirsu2|2856
ATGGTTCGCCCGTTATGGACACCTCACGTGGATCGCTTCTGTCACCAATGTCTCCAGCTCGAGCCCGCGCCAGAC
TACCCTCCCGCTGAGGTTCTCAGGCTGGCCGAGGCACAAGACGCCCTCTACACAAGGCTCTTTGCAGACAGGGCT
TCGTTATCGGGAACACCCGAACGATACCGGGCACGCTTACTCAAGGAGCTGGTGGCGCGAATCGAGGCCGCAATT
GAAGACTGGGACGAGCATGCGGTATCCGACGACCTCATGTCCGCCCTCTCCCTCCTCCTCGGCACGTCGCTGCCC
CCCGAGTCAGCATCGGTGCGGGCCAAGTGCATCGTCACCTACCACCTGTCGCTGCTCTCCCCCGGGGACCGGTGG
GACGAGCCCGGCATCAGGCTGCGGGAGAAACGGTCCCTCATTTCTGCCTGCGGAACCACCGGACTGCGCACCTGG
GAGGCGGCACTCCACCTCGGGCAGTATCTGTGTCTGCACCCGGACGTCGTGGCTGGGAAGCGCGTCTTGGAGCTC
GGCGCCGGCACGGGCTACCTCTCCATCCTGTGCGCCAAGTATCTGTCTGCGACTCATGCCGTTGTGTCGGACGGA
TCCGACGAGGTCGTTGACAGCCTGACTGGCAACTTTCGCCTCAACGTGGCCGACTCCGCACGCCTCAGCCCCAGG
ATGCTCCGTTGGGGTCGCGCCCAGCCCAGAGCGCAGGAGGGAGACCAAGGGCAGTCTCCTGTTGACGTCGTCCTC
GGGGCCGACATTACCTACGACGACCGGGCGATGCCTGCCCTCGTCGAGACCATTGTCGACCTGATGGGGCTGAGC
AGCGGCGCCGAGGTGTACATTGCCGCTACCCAGCGCAACGAGCGCACCTTTGCGACGTTTCTGGAAGTCTGCGGC
CGCAACGGCCTCGACGTCGAGGACATCACATTTCCCGTCACGCCGAGAGAGCAGCAGCGGGGCCCATTCTACGAG
AACCAAGTCGCCATCCGCATTTGCCGCCTCCTAAGAGTCTAA
Gene >Hirsu2|2856
ATGGTTCGCCCGTTATGGACACCTCACGTGGATCGCTTCTGTCACCAATGTCTCCAGCTCGAGCCCGCGCCAGAC
TACCCTCCCGCTGAGGTTCTCAGGCTGGCCGAGGCACAAGACGCCCTCTACACAAGGCTCTTTGCAGACAGGGCT
TCGTTATCGGGAACACCCGAACGATACCGGGCACGCTTACTCAAGGAGCTGGTGGCGCGAATCGAGGCCGCAATT
GAAGACTGGGACGAGCATGTGAGTGCCGCGTCGCCGCCGCCTTCGCCGCAGCTCAGCACAGCGCCGCGCACATCT
CATCCGTAGCGCCAGTGAGCTTGTGTCGCGTCTCGTCCCGCTGTCTCCGAGACCTGTCCTCTGACCCCTGGTCGC
TCTTTGGCGAAACAAGGCGGTATCCGACGACCTCATGTCCGCCCTCTCCCTCCTCCTCGGCACGTCGCTGCCCCC
CGAGTCAGCATCGGTGCGGGCCAAGTGCATCGTCACCTACCACCTGTCGCTGCTCTCCCCCGGGGACCGGTGGGA
CGAGCCCGGCATCAGGCTGCGGGAGAAACGGTCCCTCATTTCTGCCTGCGGAACCACCGGACTGCGCACCTGGGA
GGCGGCACTCCACCTCGGGCAGTATCTGTGTCTGCACCCGGACGTCGTGGCTGGGAAGCGCGTCTTGGAGCTCGG
CGCCGGCACGGGCTACCTCTCCATCCTGTGCGCCAAGTATCTGTCTGCGACTCATGCCGTTGTGTCGGACGGATC
CGACGAGGTCGTTGACAGCCTGACTGGCAACTTTCGCCTCAACGTGGCCGACTCCGCACGCCTCAGCCCCAGGAT
GCTCCGTTGGGGTCGCGCCCAGCCCAGAGCGCAGGAGGGAGACCAAGGGCAGTCTCCTGTTGACGTCGTCCTCGG
GGCCGACATTACCTACGACGACCGGGCGATGCCTGCCCTCGTCGAGACCATTGTCGACCTGATGGGGCTGAGCAG
CGGCGCCGAGGTGTACATTGCCGCTACCCAGCGCAACGAGCGCACCTTTGCGACGTTTCTGGAAGTCTGCGGCCG
CAACGGCCTCGACGTCGAGGACATCACATTTCCCGTCACGCCGAGAGAGCAGCAGCGGGGCCCATTCTACGAGAA
CCAAGTCGCCATCCGCATTTGCCGCCTCCTAAGAGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail