Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2854
Gene name
LocationContig_1702:2963..4957
Strand-
Gene length (bp)1994
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain 1.3E-15 185 337
PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain 1.6E-15 37 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8N4G0|CRED_ASPFN Probable HECT-type ubiquitin ligase-interacting protein creD OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creD PE=3 SV=1 19 539 6.0E-120
sp|Q2UM46|CRED_ASPOR Probable HECT-type ubiquitin ligase-interacting protein creD OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creD PE=3 SV=2 19 535 2.0E-119
sp|Q6SIF1|CRED_EMENI HECT-type ubiquitin ligase-interacting protein creD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creD PE=1 SV=1 19 538 5.0E-116
sp|Q4WN21|CRED_ASPFU Probable HECT-type ubiquitin ligase-interacting protein creD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creD PE=3 SV=2 12 580 2.0E-114
sp|B0Y7I1|CRED_ASPFC Probable HECT-type ubiquitin ligase-interacting protein creD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creD PE=3 SV=2 12 580 2.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8N4G0|CRED_ASPFN Probable HECT-type ubiquitin ligase-interacting protein creD OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creD PE=3 SV=1 19 539 6.0E-120
sp|Q2UM46|CRED_ASPOR Probable HECT-type ubiquitin ligase-interacting protein creD OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creD PE=3 SV=2 19 535 2.0E-119
sp|Q6SIF1|CRED_EMENI HECT-type ubiquitin ligase-interacting protein creD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creD PE=1 SV=1 19 538 5.0E-116
sp|Q4WN21|CRED_ASPFU Probable HECT-type ubiquitin ligase-interacting protein creD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creD PE=3 SV=2 12 580 2.0E-114
sp|B0Y7I1|CRED_ASPFC Probable HECT-type ubiquitin ligase-interacting protein creD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creD PE=3 SV=2 12 580 2.0E-114
sp|Q0CKB5|CRED_ASPTN Probable HECT-type ubiquitin ligase-interacting protein creD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=creD PE=3 SV=1 19 538 5.0E-114
sp|A1DMJ3|CRED_NEOFI Probable HECT-type ubiquitin ligase-interacting protein creD OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creD PE=3 SV=1 12 580 4.0E-113
sp|A1CTF4|CRED_ASPCL Probable HECT-type ubiquitin ligase-interacting protein creD OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creD PE=3 SV=2 7 547 3.0E-112
sp|Q09729|YA4C_SCHPO Arrestin domain-containing protein C31A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31A2.12 PE=1 SV=1 14 512 8.0E-71
sp|Q09889|YC9F_SCHPO Arrestin domain-containing protein C584.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.15c PE=1 SV=1 18 471 5.0E-62
sp|Q02805|ROD1_YEAST Protein ROD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROD1 PE=1 SV=1 18 341 2.0E-57
sp|Q6SCL4|APYA_EMENI HECT-type ubiquitin ligase-interacting protein apyA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apyA PE=1 SV=1 12 377 4.0E-57
sp|P43602|ROG3_YEAST Protein ROG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG3 PE=1 SV=1 18 388 3.0E-49
sp|P53244|ART5_YEAST Arrestin-related trafficking adapter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ART5 PE=1 SV=1 113 352 9.0E-17
sp|O74798|ALY2_SCHPO Putative arrestin-related trafficking adapter C2D10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2D10.04 PE=1 SV=1 41 332 3.0E-11
sp|Q8TBH0|ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens GN=ARRDC2 PE=2 SV=2 37 149 6.0E-09
sp|Q9D668|ARRD2_MOUSE Arrestin domain-containing protein 2 OS=Mus musculus GN=Arrdc2 PE=2 SV=1 39 149 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2854
MPSFKPFSSVTGRNSYSLFDIRLDQDFIVFRGNDHESSGQLLKGVVVLCLSTSLRIEDVRLRLTGTLRLAWTDQR
SSTPGVSSQKVDKSTTILDHRWAPFVGAHGKSMTLPAGNYEYPFEFTLPGDTAESVEGVPEASITYRLKATVGRG
KLAYDLHAYKHLRIIRTLEPGALEFLHAMSVENIWPNKVDYSIVIPQKAVVFGGTINMEMRFTPLLKGLELGEIT
ARFIELRDCWIQGSTGLSIREHHTEREVSHWRFEVNHDEHWHDMIEDTGQEGWALHKPLNLPKKLRQCIQDLNHH
GIKVRHKIKLTVALKNPDGHISELRATLPVSIFISPNVPFDEQGNLMNQAPGATPTEQDVGAIAPPGYGEHVLDQ
LYEDVEPAGLQTPGIQSGVSSPFYAHSRTGSADNLAAMADSAPIAPAALSSRLADVSLDPSRRNSSYTSMHSVTG
RATPPTGHHGSAPRSEPQSGSLTRSNSQEDRSERNSVEHVDVDDADLAELSRVPSYATAVRTPARSRTHTGSFPV
PDYQTALSAPRTPPTTEAGPEQLAPISETTAAEHAAVRGEHAAEPHPGLDLNMRRPHQVVS*
Coding >Hirsu2|2854
ATGCCGTCCTTCAAGCCCTTCTCTTCGGTCACAGGGCGCAACAGCTACAGCTTGTTTGATATCCGGCTCGACCAA
GACTTCATCGTCTTCCGCGGCAATGACCATGAGTCGTCCGGCCAGCTGCTCAAGGGCGTCGTCGTCCTGTGCCTC
TCGACGTCGCTGCGCATCGAGGATGTGCGCTTGCGCCTGACAGGCACTCTCCGATTGGCCTGGACGGACCAGCGG
TCGAGCACGCCGGGCGTGTCGAGCCAAAAGGTCGACAAGTCGACGACGATTCTCGACCACCGATGGGCCCCCTTC
GTCGGCGCCCACGGCAAGAGCATGACGCTGCCGGCCGGCAACTACGAGTACCCCTTCGAGTTCACCCTGCCGGGC
GACACGGCCGAGAGCGTCGAGGGCGTCCCCGAGGCCTCCATCACCTACCGCCTCAAGGCCACCGTCGGCCGCGGC
AAGCTGGCCTACGACCTGCACGCCTACAAGCACCTGCGCATCATCCGCACCCTCGAGCCCGGCGCCCTCGAGTTC
CTGCACGCCATGAGCGTCGAGAACATCTGGCCCAACAAGGTCGACTACTCCATCGTCATCCCGCAAAAGGCCGTC
GTCTTCGGCGGCACCATCAACATGGAGATGCGCTTCACCCCGCTGCTCAAGGGCCTCGAGCTGGGCGAGATCACG
GCCCGGTTCATCGAGCTCCGCGACTGCTGGATCCAGGGCTCGACCGGCCTCAGCATCCGCGAGCACCACACCGAG
CGCGAGGTCTCCCACTGGCGCTTCGAGGTGAACCACGACGAGCACTGGCACGACATGATCGAGGACACGGGCCAG
GAGGGCTGGGCCCTCCACAAGCCGCTGAACCTGCCCAAGAAGCTCCGCCAGTGCATCCAGGACCTGAACCACCAC
GGCATCAAGGTGCGCCACAAGATCAAGCTCACCGTCGCCCTCAAGAACCCGGACGGGCACATCTCCGAGCTGCGC
GCCACGCTGCCCGTGTCCATCTTCATCTCGCCCAACGTGCCGTTCGACGAGCAGGGCAACCTTATGAACCAGGCC
CCCGGCGCGACGCCGACGGAGCAGGACGTCGGCGCCATCGCGCCGCCCGGCTACGGCGAGCACGTGCTGGACCAG
CTGTACGAGGACGTCGAGCCGGCCGGCCTCCAGACGCCCGGGATCCAGTCGGGCGTCAGCAGCCCCTTCTACGCC
CACTCGCGTACCGGGTCGGCCGACAACCTGGCGGCCATGGCGGACAGCGCGCCCATCGCGCCGGCCGCGCTGTCG
TCGCGGCTCGCCGACGTCTCGCTGGACCCGTCGCGCCGAAACAGCTCGTACACGTCGATGCACTCGGTCACGGGG
CGCGCGACGCCGCCGACGGGCCACCACGGCTCGGCCCCCCGCTCCGAGCCGCAGTCGGGGAGCCTGACGAGGAGC
AACAGCCAGGAGGACCGGTCGGAGCGGAACTCGGTCGAGCACGTCGACGTCGACGACGCCGACCTGGCCGAGCTG
AGCCGGGTGCCGAGCTACGCGACGGCGGTCCGCACGCCGGCGCGGTCGCGGACGCACACGGGCAGCTTCCCCGTG
CCCGACTATCAGACGGCGCTGAGCGCGCCGCGGACGCCCCCGACGACGGAGGCCGGCCCGGAGCAGCTGGCTCCC
ATCTCCGAGACGACGGCCGCCGAGCACGCGGCGGTGAGGGGAGAGCATGCGGCCGAGCCTCACCCGGGGCTGGAC
CTGAACATGCGCAGGCCTCACCAGGTCGTCTCGTGA
Transcript >Hirsu2|2854
ATGCCGTCCTTCAAGCCCTTCTCTTCGGTCACAGGGCGCAACAGCTACAGCTTGTTTGATATCCGGCTCGACCAA
GACTTCATCGTCTTCCGCGGCAATGACCATGAGTCGTCCGGCCAGCTGCTCAAGGGCGTCGTCGTCCTGTGCCTC
TCGACGTCGCTGCGCATCGAGGATGTGCGCTTGCGCCTGACAGGCACTCTCCGATTGGCCTGGACGGACCAGCGG
TCGAGCACGCCGGGCGTGTCGAGCCAAAAGGTCGACAAGTCGACGACGATTCTCGACCACCGATGGGCCCCCTTC
GTCGGCGCCCACGGCAAGAGCATGACGCTGCCGGCCGGCAACTACGAGTACCCCTTCGAGTTCACCCTGCCGGGC
GACACGGCCGAGAGCGTCGAGGGCGTCCCCGAGGCCTCCATCACCTACCGCCTCAAGGCCACCGTCGGCCGCGGC
AAGCTGGCCTACGACCTGCACGCCTACAAGCACCTGCGCATCATCCGCACCCTCGAGCCCGGCGCCCTCGAGTTC
CTGCACGCCATGAGCGTCGAGAACATCTGGCCCAACAAGGTCGACTACTCCATCGTCATCCCGCAAAAGGCCGTC
GTCTTCGGCGGCACCATCAACATGGAGATGCGCTTCACCCCGCTGCTCAAGGGCCTCGAGCTGGGCGAGATCACG
GCCCGGTTCATCGAGCTCCGCGACTGCTGGATCCAGGGCTCGACCGGCCTCAGCATCCGCGAGCACCACACCGAG
CGCGAGGTCTCCCACTGGCGCTTCGAGGTGAACCACGACGAGCACTGGCACGACATGATCGAGGACACGGGCCAG
GAGGGCTGGGCCCTCCACAAGCCGCTGAACCTGCCCAAGAAGCTCCGCCAGTGCATCCAGGACCTGAACCACCAC
GGCATCAAGGTGCGCCACAAGATCAAGCTCACCGTCGCCCTCAAGAACCCGGACGGGCACATCTCCGAGCTGCGC
GCCACGCTGCCCGTGTCCATCTTCATCTCGCCCAACGTGCCGTTCGACGAGCAGGGCAACCTTATGAACCAGGCC
CCCGGCGCGACGCCGACGGAGCAGGACGTCGGCGCCATCGCGCCGCCCGGCTACGGCGAGCACGTGCTGGACCAG
CTGTACGAGGACGTCGAGCCGGCCGGCCTCCAGACGCCCGGGATCCAGTCGGGCGTCAGCAGCCCCTTCTACGCC
CACTCGCGTACCGGGTCGGCCGACAACCTGGCGGCCATGGCGGACAGCGCGCCCATCGCGCCGGCCGCGCTGTCG
TCGCGGCTCGCCGACGTCTCGCTGGACCCGTCGCGCCGAAACAGCTCGTACACGTCGATGCACTCGGTCACGGGG
CGCGCGACGCCGCCGACGGGCCACCACGGCTCGGCCCCCCGCTCCGAGCCGCAGTCGGGGAGCCTGACGAGGAGC
AACAGCCAGGAGGACCGGTCGGAGCGGAACTCGGTCGAGCACGTCGACGTCGACGACGCCGACCTGGCCGAGCTG
AGCCGGGTGCCGAGCTACGCGACGGCGGTCCGCACGCCGGCGCGGTCGCGGACGCACACGGGCAGCTTCCCCGTG
CCCGACTATCAGACGGCGCTGAGCGCGCCGCGGACGCCCCCGACGACGGAGGCCGGCCCGGAGCAGCTGGCTCCC
ATCTCCGAGACGACGGCCGCCGAGCACGCGGCGGTGAGGGGAGAGCATGCGGCCGAGCCTCACCCGGGGCTGGAC
CTGAACATGCGCAGGCCTCACCAGGTCGTCTCGTGA
Gene >Hirsu2|2854
ATGCCGTCCTTCAAGCCCTTCTCTTCGGTCACAGGGCGCAACAGCTACAGCTTGTTTGATATCCGGTCCGTATGC
AGCCGCGTCTTTCCCCTCGAGCCGGCCCAGGAGAAATGCTGACGACAAGGCACACCCCCTCAGGCTCGACCAAGA
CTTCATCGTCTTCCGCGGCAATGACCATGAGTCGTCCGGCCAGCTGCTCAAGGGCGTCGTCGTCCTGTGCCTCTC
GACGTCGCTGCGCATCGAGGATGTGCGCTTGCGCCTGACAGGCACTCTCCGATTGGCGTAAGCAAGCCGTCCAAC
CAAAGCTCGTCCCTTTCCTTCTCCCGCCGCCGGCCCCCCCGTCTGACCGAGCTCCGCCTCAGCTGGACGGACCAG
CGGTCGAGCACGCCGGGCGTGTCGAGCCAAAAGGTCGACAAGTCGACGACGATTCTCGACCACCGATGGGCCCCC
TTCGTCGGCGCCCACGGCAAGAGCATGACGCTGCCGGCCGGCAACTACGAGTACCCCTTCGAGTTCACCCTGCCG
GGCGACACGGCCGAGAGCGTCGAGGGCGTCCCCGAGGCCTCCATCACCTACCGCCTCAAGGCCACCGTCGGCCGC
GGCAAGCTGGCCTACGACCTGCACGCCTACAAGCACCTGCGCATCATCCGCACCCTCGAGCCCGGCGCCCTCGAG
TTCCTGCACGCCATGAGCGTCGAGAACATCTGGCCCAACAAGGTCGACTACTCCATCGTCATCCCGCAAAAGGCC
GTCGTCTTCGGCGGCACCATCAACATGGAGATGCGCTTCACCCCGCTGCTCAAGGGCCTCGAGCTGGGCGAGATC
ACGGCCCGGTTCATCGAGCTCCGCGACTGCTGGATCCAGGGCTCGACCGGCCTCAGCATCCGCGAGCACCACACC
GAGCGCGAGGTCTCCCACTGGCGCTTCGAGGTGAACCACGACGAGCACTGGCACGACATGATCGAGGACACGGGC
CAGGAGGGCTGGGCCCTCCACAAGCCGCTGAACCTGCCCAAGAAGCTCCGCCAGTGCATCCAGGACCTGAACCAC
CACGGCATCAAGGTGCGCCACAAGATCAAGCTCACCGTCGCCCTCAAGAACCCGGACGGGCACATCTCCGAGGTA
AGCGTCGCCAAGCCCCCCCGCCCCCCGCGCGCGCGCCGCGCTCCGCGTGCGTGTCGGCTGACCGCGTCCCGCCCC
AGCTGCGCGCCACGCTGCCCGTGTCCATCTTCATCTCGCCCAACGTGCCGTTCGACGAGCAGGGCAACCTTATGA
ACCAGGCCCCCGGCGCGACGCCGACGGAGCAGGACGTCGGCGCCATCGCGCCGCCCGGCTACGGCGAGCACGTGC
TGGACCAGCTGTACGAGGACGTCGAGCCGGCCGGCCTCCAGACGCCCGGGATCCAGTCGGGCGTCAGCAGCCCCT
TCTACGCCCACTCGCGTACCGGGTCGGCCGACAACCTGGCGGCCATGGCGGACAGCGCGCCCATCGCGCCGGCCG
CGCTGTCGTCGCGGCTCGCCGACGTCTCGCTGGACCCGTCGCGCCGAAACAGCTCGTACACGTCGATGCACTCGG
TCACGGGGCGCGCGACGCCGCCGACGGGCCACCACGGCTCGGCCCCCCGCTCCGAGCCGCAGTCGGGGAGCCTGA
CGAGGAGCAACAGCCAGGAGGACCGGTCGGAGCGGAACTCGGTCGAGCACGTCGACGTCGACGACGCCGACCTGG
CCGAGCTGAGCCGGGTGCCGAGCTACGCGACGGCGGTCCGCACGCCGGCGCGGTCGCGGACGCACACGGGCAGCT
TCCCCGTGCCCGACTATCAGACGGCGCTGAGCGCGCCGCGGACGCCCCCGACGACGGAGGCCGGCCCGGAGCAGC
TGGCTCCCATCTCCGAGACGACGGCCGCCGAGCACGCGGCGGTGAGGGGAGAGCATGCGGCCGAGCCTCACCCGG
GGCTGGACCTGAACATGCGCAGGCCTCACCAGGTCGTCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail