Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2850
Gene name
LocationContig_1701:1937..3066
Strand+
Gene length (bp)1129
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.6E-34 2 116
PF03169 OPT OPT oligopeptide transporter protein 2.9E-13 114 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53134|YGL4_YEAST Putative oligopeptide transporter YGL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL114W PE=1 SV=1 1 196 8.0E-59
sp|Q6ZGM7|YSL7_ORYSJ Probable metal-nicotianamine transporter YSL7 OS=Oryza sativa subsp. japonica GN=YSL7 PE=2 SV=1 13 184 1.0E-09
sp|Q6ZCX1|YSL17_ORYSJ Probable metal-nicotianamine transporter YSL17 OS=Oryza sativa subsp. japonica GN=YSL17 PE=2 SV=1 13 192 6.0E-08
sp|Q6H3Z3|YSL15_ORYSJ Iron-phytosiderophore transporter YSL15 OS=Oryza sativa subsp. japonica GN=YSL15 PE=2 SV=1 14 109 6.0E-08
sp|Q7XRV2|YSL6_ORYSJ Probable metal-nicotianamine transporter YSL6 OS=Oryza sativa subsp. japonica GN=YSL6 PE=2 SV=1 5 109 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53134|YGL4_YEAST Putative oligopeptide transporter YGL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL114W PE=1 SV=1 1 196 8.0E-59
sp|Q6ZGM7|YSL7_ORYSJ Probable metal-nicotianamine transporter YSL7 OS=Oryza sativa subsp. japonica GN=YSL7 PE=2 SV=1 13 184 1.0E-09
sp|Q6ZCX1|YSL17_ORYSJ Probable metal-nicotianamine transporter YSL17 OS=Oryza sativa subsp. japonica GN=YSL17 PE=2 SV=1 13 192 6.0E-08
sp|Q6H3Z3|YSL15_ORYSJ Iron-phytosiderophore transporter YSL15 OS=Oryza sativa subsp. japonica GN=YSL15 PE=2 SV=1 14 109 6.0E-08
sp|Q7XRV2|YSL6_ORYSJ Probable metal-nicotianamine transporter YSL6 OS=Oryza sativa subsp. japonica GN=YSL6 PE=2 SV=1 5 109 2.0E-07
sp|Q5JQD7|YSL12_ORYSJ Probable metal-nicotianamine transporter YSL12 OS=Oryza sativa subsp. japonica GN=YSL12 PE=2 SV=2 5 107 8.0E-07
sp|Q6H3Z6|YSL2_ORYSJ Metal-nicotianamine transporter YSL2 OS=Oryza sativa subsp. japonica GN=YSL2 PE=2 SV=2 14 179 1.0E-06
sp|Q7XN54|YSL16_ORYSJ Probable metal-nicotianamine transporter YSL16 OS=Oryza sativa subsp. japonica GN=YSL16 PE=2 SV=2 1 109 4.0E-06
sp|Q6R3K9|YSL2_ARATH Metal-nicotianamine transporter YSL2 OS=Arabidopsis thaliana GN=YSL2 PE=1 SV=1 1 179 6.0E-06
sp|Q9AY27|YS1_MAIZE Iron-phytosiderophore transporter yellow stripe 1 OS=Zea mays GN=YS1 PE=2 SV=1 14 109 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 124 146 22
3 166 188 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2850
MALPLSIMGVRALGETDLNPVSGISKMAQLFFALIIPKSNKSSVLINLVAGAVSEAGALQAGDLMQDLKTGHLLG
AAPKAQFWGQVIGATVGAILSAFLYRIYTRVYTIPTLARAVSARKAWRPLIPGGVAVAVGMYNIPSFTLARAIGG
LFSWYWVGVTKRSQTPLVILASGFILGEGFLSIINLVLQSLEVPHF*
Coding >Hirsu2|2850
ATGGCACTGCCTCTGAGTATTATGGGTGTGCGGGCGCTGGGCGAGACAGACCTCAACCCGGTCTCTGGTATCAGC
AAGATGGCCCAATTATTCTTCGCCCTCATCATTCCCAAATCCAATAAATCCAGCGTTCTCATCAACCTTGTCGCG
GGTGCTGTGTCTGAAGCTGGCGCACTGCAGGCTGGTGACTTAATGCAAGATCTCAAGACGGGACACCTACTCGGA
GCTGCTCCAAAGGCTCAATTTTGGGGTCAAGTGATAGGTGCTACCGTCGGCGCCATCCTCAGCGCTTTCCTGTAT
CGCATCTACACCCGGGTCTACACGATACCCACCCTGGCTCGAGCTGTCTCGGCCCGGAAAGCCTGGCGTCCCTTG
ATTCCGGGAGGCGTCGCGGTTGCAGTTGGCATGTACAATATTCCTTCCTTCACGCTAGCTCGAGCTATAGGCGGC
CTCTTTAGTTGGTACTGGGTTGGAGTGACCAAGCGATCACAAACGCCGCTTGTCATTCTCGCATCAGGTTTCATT
CTTGGTGAGGGATTCCTCAGCATAATTAATCTGGTCCTGCAAAGCCTGGAGGTACCTCATTTCTAG
Transcript >Hirsu2|2850
ATGGCACTGCCTCTGAGTATTATGGGTGTGCGGGCGCTGGGCGAGACAGACCTCAACCCGGTCTCTGGTATCAGC
AAGATGGCCCAATTATTCTTCGCCCTCATCATTCCCAAATCCAATAAATCCAGCGTTCTCATCAACCTTGTCGCG
GGTGCTGTGTCTGAAGCTGGCGCACTGCAGGCTGGTGACTTAATGCAAGATCTCAAGACGGGACACCTACTCGGA
GCTGCTCCAAAGGCTCAATTTTGGGGTCAAGTGATAGGTGCTACCGTCGGCGCCATCCTCAGCGCTTTCCTGTAT
CGCATCTACACCCGGGTCTACACGATACCCACCCTGGCTCGAGCTGTCTCGGCCCGGAAAGCCTGGCGTCCCTTG
ATTCCGGGAGGCGTCGCGGTTGCAGTTGGCATGTACAATATTCCTTCCTTCACGCTAGCTCGAGCTATAGGCGGC
CTCTTTAGTTGGTACTGGGTTGGAGTGACCAAGCGATCACAAACGCCGCTTGTCATTCTCGCATCAGGTTTCATT
CTTGGTGAGGGATTCCTCAGCATAATTAATCTGGTCCTGCAAAGCCTGGAGGTACCTCATTTCTAG
Gene >Hirsu2|2850
ATGGCACTGCCTCTGAGTATTATGGGTGTGCGGGCGCTGGGCGAGACAGACCTCAACCCGGTCTCTGGTATCAGC
AAGATGGCCCAATTATTCTTCGCCCTCATCATTCCCAAATCCAATAAATCCAGCGTTCTCATCAACCTTGTCGCG
GGTGCTGTGGTAAATCTCCCCTCTTCCTTTCTGCCCATCTTCATCTAGCTTCGCATCTGATTATCGCCCTGACTC
CGTCCTCCATTTACGACGTACTTGATGTCGCTGACTGGGTTTTTGGACGATACGCAGTCTGAAGCTGTAAGTCTA
ATCTGCACTACTGCGCCAAAGGGAAAGTGCGCCGCACTCACAATTTTCGGCCAACAAGGGCGCACTGCAGGCTGG
TGACTTAATGCAAGATCTCAAGACGGGACACCTACTCGGAGCTGCTCCAAAGGCTCAATTTTGGGGTCAAGTGAT
AGGTGCTACCGTCGGCGCCATCCTCAGCGCTTTCCTGTATCGCATCTACACCCGGTAGGCTATATACCCAAATCT
TCTCCCTCTTTTCCTCAGAAGCCCACTTTGAATCAACCCAGCCCTGGCGCAGCTAGCTGAACCAGATGTCCTGAC
GGGTTGACTATTTCAGGGTCTACACGATACCCAGTGAGCTTTTTGAAGTTCCGACGGCCTACGTTTGGATCTTCA
CCGCCAGATTTGTAACGGGCCAAGGGCTGCCACCAATGGCAAAAGAGTGGGCAGTAGCCGCAGGCGTTACATTTG
CTTTTGCAGCCCTGGCTCGAGCTGTCTCGGCCCGGAAAGCCTGGCGTCCCTTGATTCCGGGAGGCGTCGCGGTTG
CAGTTGGTATGTTTTTGGAACCACGGCTGCGAGCCGGTAGTCACTCACCGTCAATATTCAATAGGCATGTACAAT
ATTCCTTCCTTCACGCTAGCTCGAGCTATAGGCGGCCTCTTTAGTTGGTACTGGGTTGGAGTGACCAAGCGATCA
CAAACGCCGCTTGTCATTCTCGCATCAGTAATGCTCCAAACACATTGATCGGCTTTCCGTCACGCTAACTAATCA
ACAGGGTTTCATTCTTGGTGAGGGATTCCTCAGCATAATTAATCTGGTCCTGCAAAGCCTGGAGGTACCTCATTT
CTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail