Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2849
Gene name
LocationContig_1701:436..894
Strand+
Gene length (bp)458
Transcript length (bp)399
Coding sequence length (bp)399
Protein length (aa) 133

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 8.6E-31 9 132

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53134|YGL4_YEAST Putative oligopeptide transporter YGL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL114W PE=1 SV=1 9 132 5.0E-24

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 35 57 22
3 70 92 22
4 107 129 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2849
MSAFRDQFLTIRSVAAGLLVGTVFCAANVYFGLQTGWVSIMSMPASLMGFGLFRLLRRHLSFPFTPVENVLLQSV
ACGMAIMPLGCGFVGVIPAMNYLLKPEEKGPLSLSTTQLVAWSLGLCYFGVVFAVPL*
Coding >Hirsu2|2849
ATGTCTGCTTTTCGAGATCAGTTTCTCACGATCCGCAGCGTGGCTGCGGGCCTCCTCGTGGGCACCGTCTTTTGT
GCGGCTAACGTGTACTTCGGCCTTCAGACAGGATGGGTGTCCATCATGTCCATGCCCGCCAGCCTCATGGGCTTC
GGCCTATTTCGGCTATTGCGCCGACATCTATCTTTCCCTTTCACCCCCGTTGAGAACGTTCTCCTCCAAAGTGTT
GCATGTGGCATGGCCATCATGCCCCTCGGCTGTGGCTTTGTTGGCGTCATTCCGGCCATGAATTACCTGTTGAAG
CCGGAGGAGAAGGGCCCTTTGTCTCTAAGCACTACTCAACTTGTGGCCTGGTCCTTGGGCCTCTGCTACTTCGGT
GTGGTCTTTGCCGTGCCCCTGTGA
Transcript >Hirsu2|2849
ATGTCTGCTTTTCGAGATCAGTTTCTCACGATCCGCAGCGTGGCTGCGGGCCTCCTCGTGGGCACCGTCTTTTGT
GCGGCTAACGTGTACTTCGGCCTTCAGACAGGATGGGTGTCCATCATGTCCATGCCCGCCAGCCTCATGGGCTTC
GGCCTATTTCGGCTATTGCGCCGACATCTATCTTTCCCTTTCACCCCCGTTGAGAACGTTCTCCTCCAAAGTGTT
GCATGTGGCATGGCCATCATGCCCCTCGGCTGTGGCTTTGTTGGCGTCATTCCGGCCATGAATTACCTGTTGAAG
CCGGAGGAGAAGGGCCCTTTGTCTCTAAGCACTACTCAACTTGTGGCCTGGTCCTTGGGCCTCTGCTACTTCGGT
GTGGTCTTTGCCGTGCCCCTGTGA
Gene >Hirsu2|2849
ATGTCTGCTTTTCGAGATCAGTTTCTCACGATCCGCAGCGTGGCTGCGGGCCTCCTCGTGGGCACCGTCTTTTGT
GCGGCTAACGTGTACTTCGGCCTTCAGACAGGATGGGTGTCCATCATGTCCATGCCCGCCAGCCTCATGGGCTTC
GGCCTATTTCGGCTATTGCGCCGACATCTATCTTTCCCTTTCACCCCCGTTGAGAACGTTCTCCTCCAAAGTGTT
GCATGTGGCATGGCCATCATGCCCCTCGGCTGTGGCTTTGTTGGCGTCGTTAGTGGAGTCTCCGTACTACTACAA
TGCGCACACCAAGCTAATAACATCTTCCACAGATTCCGGCCATGAATTACCTGTTGAAGCCGGAGGAGAAGGGCC
CTTTGTCTCTAAGCACTACTCAACTTGTGGCCTGGTCCTTGGGCCTCTGCTACTTCGGTGTGGTCTTTGCCGTGC
CCCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail