Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2847
Gene name
LocationContig_1700:810..2335
Strand-
Gene length (bp)1525
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 6.6E-07 17 132

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5537 0.5968 0.1078 0.1376 0.3153 0.0474 0.0615 0.086 0.0523 0.0093

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2227
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1829
Ophiocordyceps australis map64 (Brazil) OphauB2|1529
Ophiocordyceps camponoti-floridani Ophcf2|03690
Ophiocordyceps camponoti-rufipedis Ophun1|2358
Ophiocordyceps kimflemingae Ophio5|3180
Ophiocordyceps subramaniannii Hirsu2|2847 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2847
MSTTPIKFDVPDGCRLFLPFPRLPAEIRHRIWELCLCEPGVNFVKLQVWENGWLSGRWSPRPAPTALDADAGRDL
DDVELVLRDHDRRPRPHLHARLVSLSPSRRADASNYEQLHARLAVLSKTCLESAALARSLVLRPGVLRFDNGNVI
ALRRSPDLVFLEYLPPDLYHGARTLDVCFFCPGLDLVRRVAMRFSHHWSPRRTRPDCTSCGKPHDHTDPGSYPAH
LYQFLARCLPSLEEFYFVDYFIVPRTHVEADAGESSMSVDGDDDAAPCFDGGESDGPQAPQPLQVFRAKNRRFRE
VGDGETGRRRWKMEPKVSQIRDWLRDRFVRYARTSHTSRHRSPERVRFGILACEWDVCVPESRGMEQQHAAPPQP
RRRARTPPNRPSAASDDGKTTRVLNGSAAVAGVNGGGTRHPDSRASSSSVRSSPRGTEREESGQETGRSDNNKTT
VYHFGADASFSFDFTFRETYGSTRRRFGR*
Coding >Hirsu2|2847
ATGTCGACGACACCCATCAAGTTCGACGTGCCTGATGGGTGCCGCCTCTTCCTGCCCTTCCCGCGCCTGCCCGCC
GAGATCCGCCACCGGATCTGGGAGCTGTGCCTGTGCGAGCCGGGCGTCAACTTCGTCAAGCTCCAGGTGTGGGAG
AACGGCTGGCTGTCGGGTCGCTGGTCGCCCCGGCCGGCCCCGACGGCCCTCGATGCCGACGCCGGCCGCGACCTG
GACGACGTCGAGCTCGTCCTGAGGGACCACGACCGCCGCCCGCGCCCCCACCTCCACGCCCGCCTCGTCTCCCTC
AGCCCCAGCCGCAGGGCCGACGCCTCCAACTACGAGCAGCTCCACGCCCGGCTCGCCGTCCTGTCCAAGACGTGC
CTCGAGTCGGCCGCCCTGGCTAGGAGCTTGGTCTTGAGGCCCGGCGTCCTCCGCTTCGACAACGGCAACGTCATC
GCCCTGCGCCGCTCGCCCGACCTCGTCTTCCTCGAGTACCTGCCCCCGGACCTCTACCACGGCGCCCGCACCCTC
GACGTCTGCTTCTTCTGCCCCGGCCTCGACCTGGTCCGCCGCGTCGCCATGCGCTTCTCCCACCACTGGTCCCCC
CGCCGCACGCGCCCGGACTGCACCTCGTGCGGGAAGCCCCACGACCACACCGACCCGGGATCCTATCCCGCCCAC
CTGTACCAGTTTCTGGCCAGATGCCTGCCCAGCCTCGAGGAGTTCTACTTCGTCGACTACTTCATCGTCCCCCGC
ACCCATGTCGAGGCCGACGCCGGCGAAAGCTCCATGTCCGTGGACGGCGACGACGATGCCGCGCCGTGTTTCGAC
GGCGGCGAGAGCGACGGCCCTCAAGCGCCACAGCCGCTGCAAGTCTTTCGCGCAAAGAACCGACGATTCCGCGAA
GTCGGCGACGGCGAGACCGGCCGCCGCCGCTGGAAGATGGAGCCCAAGGTGTCGCAGATCCGAGACTGGCTCCGC
GACCGCTTCGTGCGCTACGCCAGGACGAGCCACACGAGCCGACACAGGTCGCCGGAGCGCGTCCGCTTCGGCATC
CTGGCCTGCGAGTGGGACGTTTGCGTGCCGGAGTCGCGCGGCATGGAGCAGCAGCACGCCGCGCCGCCCCAGCCT
CGCCGCCGCGCCAGGACGCCGCCCAACAGGCCGTCCGCGGCGTCCGACGACGGCAAGACGACACGCGTGCTCAAC
GGCTCGGCAGCCGTTGCGGGCGTGAACGGCGGGGGAACTCGGCATCCCGATAGTCGGGCGTCGTCGTCGTCGGTC
CGTTCTAGTCCCCGGGGGACGGAGAGGGAGGAATCGGGCCAGGAAACGGGACGGTCGGACAACAACAAGACTACG
GTCTACCATTTCGGAGCGGACGCCTCCTTCTCCTTTGACTTCACCTTTAGAGAAACGTACGGGTCGACTCGAAGA
CGGTTTGGTCGGTAG
Transcript >Hirsu2|2847
ATGTCGACGACACCCATCAAGTTCGACGTGCCTGATGGGTGCCGCCTCTTCCTGCCCTTCCCGCGCCTGCCCGCC
GAGATCCGCCACCGGATCTGGGAGCTGTGCCTGTGCGAGCCGGGCGTCAACTTCGTCAAGCTCCAGGTGTGGGAG
AACGGCTGGCTGTCGGGTCGCTGGTCGCCCCGGCCGGCCCCGACGGCCCTCGATGCCGACGCCGGCCGCGACCTG
GACGACGTCGAGCTCGTCCTGAGGGACCACGACCGCCGCCCGCGCCCCCACCTCCACGCCCGCCTCGTCTCCCTC
AGCCCCAGCCGCAGGGCCGACGCCTCCAACTACGAGCAGCTCCACGCCCGGCTCGCCGTCCTGTCCAAGACGTGC
CTCGAGTCGGCCGCCCTGGCTAGGAGCTTGGTCTTGAGGCCCGGCGTCCTCCGCTTCGACAACGGCAACGTCATC
GCCCTGCGCCGCTCGCCCGACCTCGTCTTCCTCGAGTACCTGCCCCCGGACCTCTACCACGGCGCCCGCACCCTC
GACGTCTGCTTCTTCTGCCCCGGCCTCGACCTGGTCCGCCGCGTCGCCATGCGCTTCTCCCACCACTGGTCCCCC
CGCCGCACGCGCCCGGACTGCACCTCGTGCGGGAAGCCCCACGACCACACCGACCCGGGATCCTATCCCGCCCAC
CTGTACCAGTTTCTGGCCAGATGCCTGCCCAGCCTCGAGGAGTTCTACTTCGTCGACTACTTCATCGTCCCCCGC
ACCCATGTCGAGGCCGACGCCGGCGAAAGCTCCATGTCCGTGGACGGCGACGACGATGCCGCGCCGTGTTTCGAC
GGCGGCGAGAGCGACGGCCCTCAAGCGCCACAGCCGCTGCAAGTCTTTCGCGCAAAGAACCGACGATTCCGCGAA
GTCGGCGACGGCGAGACCGGCCGCCGCCGCTGGAAGATGGAGCCCAAGGTGTCGCAGATCCGAGACTGGCTCCGC
GACCGCTTCGTGCGCTACGCCAGGACGAGCCACACGAGCCGACACAGGTCGCCGGAGCGCGTCCGCTTCGGCATC
CTGGCCTGCGAGTGGGACGTTTGCGTGCCGGAGTCGCGCGGCATGGAGCAGCAGCACGCCGCGCCGCCCCAGCCT
CGCCGCCGCGCCAGGACGCCGCCCAACAGGCCGTCCGCGGCGTCCGACGACGGCAAGACGACACGCGTGCTCAAC
GGCTCGGCAGCCGTTGCGGGCGTGAACGGCGGGGGAACTCGGCATCCCGATAGTCGGGCGTCGTCGTCGTCGGTC
CGTTCTAGTCCCCGGGGGACGGAGAGGGAGGAATCGGGCCAGGAAACGGGACGGTCGGACAACAACAAGACTACG
GTCTACCATTTCGGAGCGGACGCCTCCTTCTCCTTTGACTTCACCTTTAGAGAAACGTACGGGTCGACTCGAAGA
CGGTTTGGTCGGTAG
Gene >Hirsu2|2847
ATGTCGACGACACCCATCAAGTTCGACGTGCCTGATGGGTGCCGCCTCTTCCTGCCCTTCCCGCGCCTGCCCGCC
GAGATCCGCCACCGGATCTGGGAGCTGTGCCTGTGCGAGCCGGGCGTCAACTTCGTCAAGCTCCAGGTGTGGGAG
AACGGCTGGCTGTCGGGTCGCTGGTCGCCCCGGCCGGCCCCGACGGCCCTCGATGCCGACGCCGGCCGCGACCTG
GACGACGTCGAGCTCGTCCTGAGGGACCACGACCGCCGCCCGCGCCCCCACCTCCACGCCCGCCTCGTCTCCCTC
AGCCCCAGCCGCAGGGCCGACGCCTCCAACTACGAGCAGCTCCACGCCCGGCTCGCCGTCCTGTCCAAGACGTGC
CTCGAGTCGGCCGCCCTGGCTAGGAGCTTGGTCTTGAGGCCCGGCGTCCTCCGCTTCGACAACGGCAACGTCATC
GCCCTGCGCCGCTCGCCCGACCTCGTCTTCCTCGAGTACCTGCCCCCGGACCTCTACCACGGCGCCCGCACCCTC
GACGTCTGCTTCTTCTGCCCCGGCCTCGACCTGGTCCGCCGCGTCGCCATGCGCTTCTCCCACCACTGGTCCCCC
CGCCGCACGCGCCCGGACTGCACCTCGTGCGGGAAGCCCCACGACCACACCGACCCGGGATCCTATCCCGCCCAC
CTGTACCAGTTTCTGGCCAGATGCCTGCCCAGCCTCGAGGAGTTCTACTTCGTCGACTACTTCATCGTCCCCCGC
ACCCATGTCGAGGCCGACGCCGGCGAAAGCTCCATGTCCGTGGACGGCGACGACGATGCCGCGCCGTGTTTCGAC
GGCGGCGAGAGCGACGGCCCTCAAGGTGAGTGGGGAGCGAGGCCACCATGAACCCAGAACCCCCCCCAACGTGGA
CACCACGAGCTGATCCGGGCCGACGCCAAACACAGCGCCACAGCCGCTGCAAGTCTTTCGCGCAAAGAACCGACG
ATTCCGCGAAGTCGGCGACGGCGAGACCGGCCGCCGCCGCTGGAAGATGGAGCCCAAGGTGTCGCAGATCCGAGA
CTGGCTCCGCGACCGCTTCGTGCGCTACGCCAGGACGAGCCACACGAGCCGACACAGGTCGCCGGAGCGCGTCCG
CTTCGGCATCCTGGCCTGCGAGTGGGACGTTTGCGTGCCGGAGTCGCGCGGCATGGAGCAGCAGCACGCCGCGCC
GCCCCAGCCTCGCCGCCGCGCCAGGACGCCGCCCAACAGGCCGTCCGCGGCGTCCGACGACGGCAAGACGACACG
CGTGCTCAACGGCTCGGCAGCCGTTGCGGGCGTGAACGGCGGGGGAACTCGGCATCCCGATAGTCGGGCGTCGTC
GTCGTCGGTCCGTTCTAGTCCCCGGGGGACGGAGAGGGAGGAATCGGGCCAGGAAACGGGACGGTCGGACAACAA
CAAGACTACGGTCTACCATTTCGGAGCGGACGCCTCCTTCTCCTTTGACTTCACCTTTAGAGAAACGTACGGGTC
GACTCGAAGACGGTTTGGTCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail