Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2845
Gene name
LocationContig_170:29099..31267
Strand+
Gene length (bp)2168
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05602 CLPTM1 Cleft lip and palate transmembrane protein 1 (CLPTM1) 6.2E-148 35 511

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O96005|CLPT1_HUMAN Cleft lip and palate transmembrane protein 1 OS=Homo sapiens GN=CLPTM1 PE=1 SV=1 153 622 2.0E-107
sp|Q2NL17|CLPT1_BOVIN Cleft lip and palate transmembrane protein 1 homolog OS=Bos taurus GN=CLPTM1 PE=2 SV=1 153 617 9.0E-107
sp|Q8VBZ3|CLPT1_MOUSE Cleft lip and palate transmembrane protein 1 homolog OS=Mus musculus GN=Clptm1 PE=1 SV=1 153 617 2.0E-103
sp|Q6DEL2|CLPT1_DANRE Cleft lip and palate transmembrane protein 1 homolog OS=Danio rerio GN=clptm1 PE=2 SV=1 156 638 7.0E-100
sp|Q54RJ1|CNRB_DICDI CLPTM1-like membrane protein cnrB OS=Dictyostelium discoideum GN=cnrB PE=3 SV=1 94 608 2.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O96005|CLPT1_HUMAN Cleft lip and palate transmembrane protein 1 OS=Homo sapiens GN=CLPTM1 PE=1 SV=1 153 622 2.0E-107
sp|Q2NL17|CLPT1_BOVIN Cleft lip and palate transmembrane protein 1 homolog OS=Bos taurus GN=CLPTM1 PE=2 SV=1 153 617 9.0E-107
sp|Q8VBZ3|CLPT1_MOUSE Cleft lip and palate transmembrane protein 1 homolog OS=Mus musculus GN=Clptm1 PE=1 SV=1 153 617 2.0E-103
sp|Q6DEL2|CLPT1_DANRE Cleft lip and palate transmembrane protein 1 homolog OS=Danio rerio GN=clptm1 PE=2 SV=1 156 638 7.0E-100
sp|Q54RJ1|CNRB_DICDI CLPTM1-like membrane protein cnrB OS=Dictyostelium discoideum GN=cnrB PE=3 SV=1 94 608 2.0E-93
sp|Q5R7B1|CLP1L_PONAB Cleft lip and palate transmembrane protein 1-like protein OS=Pongo abelii GN=CLPTM1L PE=2 SV=1 129 628 9.0E-85
sp|Q96KA5|CLP1L_HUMAN Cleft lip and palate transmembrane protein 1-like protein OS=Homo sapiens GN=CLPTM1L PE=1 SV=1 129 628 4.0E-84
sp|Q5ZKJ0|CLP1L_CHICK Cleft lip and palate transmembrane protein 1-like protein OS=Gallus gallus GN=CLPTM1L PE=2 SV=1 90 615 2.0E-80
sp|Q8BXA5|CLP1L_MOUSE Cleft lip and palate transmembrane protein 1-like protein OS=Mus musculus GN=Clptm1l PE=1 SV=1 129 615 2.0E-80
sp|Q6DHU1|CLP1L_DANRE Cleft lip and palate transmembrane protein 1-like protein OS=Danio rerio GN=clptm1l PE=2 SV=1 111 629 9.0E-80
sp|A2VE61|CLP1L_BOVIN Cleft lip and palate transmembrane protein 1-like protein OS=Bos taurus GN=CLPTM1L PE=2 SV=1 129 615 1.0E-77
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 364 386 22
2 399 421 22
3 431 450 19
4 488 510 22
5 520 542 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2845
MPSSSAGPAAGQPQQQEQRGGGFNLNRLLLGGAVYFGLNYLMSYAMQKNQRGVAVTNPETGQVVTVAGNTDGIPP
YELRPRTLDEGAQYRPVPAKIAPIWPQDSRLDIVVTLSPSFSPAPLSQTPAEYVVLREHGFHMDNRSDARSVDTT
FAVPPAVQRNGTLWGHFYVGLAGSVLDPRQPGFDPGAAYHFAHPLTQYLAKKKVAKTRNLLEGRADAAAADAADD
QRGPVIASHYHPNASFAFVPAMGVRDFSQLHPAIKQFLRLEATGARDGSGQNGWYYPLLFVNNFWQLTSHMTVLN
ETVKELPLHIELKNMAFWQFQLLASIEMNSKENARQAAHGASLPGGGDGTEIEMVKEIFIDTNPILLAITAVVTV
AHLILETLAFGSDIAHYRKKKDNVGISVRSILANVVMQAIIFLYLLDNSQNTSWMILGTQVVGIVIELWKITTVV
DVRVRPAPAGSLLPWRLAMEDKHTLTETEEKTKEYDEIAFRYMYMAAVPLLVAYGAYSLVYESHKSWYSFVITTL
VGSVYTYGFLMMVPSLYINYRLKSVAHMPAKAMMYKFLNTFIDDLFAFTIKMPILHRLATFRDDVIFFVYLYQKW
AYRTDYTRVNEFGQGGDGDEAAKAEATEEKKEEEEEEEAAEEEGGAGNKSKSKSKSKSKSKTGPAGEATGRDARQ
AATRRR*
Coding >Hirsu2|2845
ATGCCCTCGTCCTCAGCCGGGCCGGCGGCGGGCCAGCCGCAGCAGCAGGAACAACGAGGAGGCGGCTTCAACCTC
AACCGGCTGCTGCTCGGCGGCGCCGTCTACTTCGGCCTCAACTACCTCATGTCGTACGCGATGCAGAAGAACCAG
CGGGGCGTGGCCGTGACCAACCCCGAGACGGGCCAGGTGGTGACGGTGGCCGGCAACACGGACGGCATCCCGCCC
TACGAGCTGCGGCCCCGGACGCTCGACGAGGGCGCCCAGTACCGGCCGGTGCCGGCCAAGATCGCGCCCATCTGG
CCGCAGGACAGCCGGCTCGACATCGTCGTCACCCTGTCGCCGTCGTTCAGCCCGGCGCCGCTGTCGCAGACGCCG
GCCGAGTACGTCGTCCTGCGCGAGCACGGCTTCCACATGGACAACCGGTCGGACGCGCGCTCCGTCGACACCACC
TTCGCCGTGCCGCCGGCCGTCCAGCGCAACGGCACGCTCTGGGGCCACTTCTACGTCGGCCTCGCCGGCAGCGTC
CTCGACCCGCGCCAGCCGGGCTTCGACCCGGGCGCCGCCTACCACTTCGCCCACCCGCTGACGCAGTACCTGGCC
AAGAAGAAGGTGGCCAAGACGCGGAACCTGCTCGAGGGCCGCGCCGACGCGGCCGCGGCCGACGCGGCCGACGAC
CAGCGCGGGCCCGTCATCGCCAGCCACTACCACCCCAACGCCAGCTTCGCCTTCGTGCCGGCCATGGGCGTCCGG
GACTTTTCGCAGCTGCACCCGGCCATCAAGCAGTTTCTGCGGCTCGAGGCAACGGGGGCGCGCGACGGCAGCGGC
CAAAACGGCTGGTACTACCCGCTCTTGTTCGTCAACAACTTCTGGCAGCTGACGAGCCACATGACGGTGCTCAAC
GAGACGGTCAAGGAGCTGCCGCTGCACATCGAGCTCAAGAACATGGCGTTTTGGCAGTTCCAGCTGCTGGCGTCG
ATCGAGATGAACTCCAAGGAGAACGCGCGGCAGGCGGCGCACGGGGCGTCGCTGCCCGGTGGCGGCGACGGAACC
GAGATCGAGATGGTCAAGGAGATCTTTATCGACACCAACCCGATCCTGCTGGCCATCACGGCCGTGGTGACGGTG
GCGCACCTGATCCTCGAGACGTTGGCCTTTGGGTCGGACATTGCGCACTACCGCAAGAAGAAGGACAACGTCGGC
ATCTCGGTGCGGTCGATCCTGGCCAACGTGGTGATGCAGGCCATCATCTTCCTGTACCTGCTCGACAACTCGCAG
AACACGAGCTGGATGATCCTGGGGACGCAGGTGGTGGGCATCGTCATCGAGTTGTGGAAAATAACGACGGTCGTC
GACGTGCGGGTGCGGCCGGCGCCGGCCGGATCGCTGCTGCCGTGGCGGCTGGCGATGGAGGACAAGCACACGCTG
ACGGAGACGGAGGAGAAGACGAAGGAGTACGACGAGATCGCGTTCCGGTACATGTACATGGCGGCGGTGCCGCTG
CTGGTGGCGTACGGGGCCTACTCGCTGGTGTACGAGTCGCACAAGTCGTGGTACTCGTTCGTCATCACGACGCTG
GTCGGGTCCGTCTACACGTACGGCTTCCTGATGATGGTGCCGTCGCTCTACATCAACTACCGGCTCAAGAGCGTG
GCGCACATGCCGGCCAAGGCGATGATGTACAAGTTCCTCAACACCTTCATCGACGACCTGTTCGCCTTCACCATC
AAGATGCCGATCCTGCACCGGCTGGCGACGTTCCGCGACGACGTCATCTTCTTCGTCTACCTGTACCAGAAGTGG
GCGTACCGGACCGACTACACGCGCGTCAACGAGTTTGGCCAGGGCGGCGACGGCGACGAGGCGGCCAAGGCCGAG
GCCACGGAGGAGAAGAAGGAGGAGGAGGAGGAGGAGGAGGCGGCGGAGGAGGAGGGCGGCGCCGGCAACAAGAGC
AAGAGCAAGAGCAAGAGCAAGAGCAAGAGCAAGACAGGGCCGGCGGGCGAGGCGACGGGACGCGATGCCCGACAG
GCGGCGACCCGGCGCCGGTGA
Transcript >Hirsu2|2845
ATGCCCTCGTCCTCAGCCGGGCCGGCGGCGGGCCAGCCGCAGCAGCAGGAACAACGAGGAGGCGGCTTCAACCTC
AACCGGCTGCTGCTCGGCGGCGCCGTCTACTTCGGCCTCAACTACCTCATGTCGTACGCGATGCAGAAGAACCAG
CGGGGCGTGGCCGTGACCAACCCCGAGACGGGCCAGGTGGTGACGGTGGCCGGCAACACGGACGGCATCCCGCCC
TACGAGCTGCGGCCCCGGACGCTCGACGAGGGCGCCCAGTACCGGCCGGTGCCGGCCAAGATCGCGCCCATCTGG
CCGCAGGACAGCCGGCTCGACATCGTCGTCACCCTGTCGCCGTCGTTCAGCCCGGCGCCGCTGTCGCAGACGCCG
GCCGAGTACGTCGTCCTGCGCGAGCACGGCTTCCACATGGACAACCGGTCGGACGCGCGCTCCGTCGACACCACC
TTCGCCGTGCCGCCGGCCGTCCAGCGCAACGGCACGCTCTGGGGCCACTTCTACGTCGGCCTCGCCGGCAGCGTC
CTCGACCCGCGCCAGCCGGGCTTCGACCCGGGCGCCGCCTACCACTTCGCCCACCCGCTGACGCAGTACCTGGCC
AAGAAGAAGGTGGCCAAGACGCGGAACCTGCTCGAGGGCCGCGCCGACGCGGCCGCGGCCGACGCGGCCGACGAC
CAGCGCGGGCCCGTCATCGCCAGCCACTACCACCCCAACGCCAGCTTCGCCTTCGTGCCGGCCATGGGCGTCCGG
GACTTTTCGCAGCTGCACCCGGCCATCAAGCAGTTTCTGCGGCTCGAGGCAACGGGGGCGCGCGACGGCAGCGGC
CAAAACGGCTGGTACTACCCGCTCTTGTTCGTCAACAACTTCTGGCAGCTGACGAGCCACATGACGGTGCTCAAC
GAGACGGTCAAGGAGCTGCCGCTGCACATCGAGCTCAAGAACATGGCGTTTTGGCAGTTCCAGCTGCTGGCGTCG
ATCGAGATGAACTCCAAGGAGAACGCGCGGCAGGCGGCGCACGGGGCGTCGCTGCCCGGTGGCGGCGACGGAACC
GAGATCGAGATGGTCAAGGAGATCTTTATCGACACCAACCCGATCCTGCTGGCCATCACGGCCGTGGTGACGGTG
GCGCACCTGATCCTCGAGACGTTGGCCTTTGGGTCGGACATTGCGCACTACCGCAAGAAGAAGGACAACGTCGGC
ATCTCGGTGCGGTCGATCCTGGCCAACGTGGTGATGCAGGCCATCATCTTCCTGTACCTGCTCGACAACTCGCAG
AACACGAGCTGGATGATCCTGGGGACGCAGGTGGTGGGCATCGTCATCGAGTTGTGGAAAATAACGACGGTCGTC
GACGTGCGGGTGCGGCCGGCGCCGGCCGGATCGCTGCTGCCGTGGCGGCTGGCGATGGAGGACAAGCACACGCTG
ACGGAGACGGAGGAGAAGACGAAGGAGTACGACGAGATCGCGTTCCGGTACATGTACATGGCGGCGGTGCCGCTG
CTGGTGGCGTACGGGGCCTACTCGCTGGTGTACGAGTCGCACAAGTCGTGGTACTCGTTCGTCATCACGACGCTG
GTCGGGTCCGTCTACACGTACGGCTTCCTGATGATGGTGCCGTCGCTCTACATCAACTACCGGCTCAAGAGCGTG
GCGCACATGCCGGCCAAGGCGATGATGTACAAGTTCCTCAACACCTTCATCGACGACCTGTTCGCCTTCACCATC
AAGATGCCGATCCTGCACCGGCTGGCGACGTTCCGCGACGACGTCATCTTCTTCGTCTACCTGTACCAGAAGTGG
GCGTACCGGACCGACTACACGCGCGTCAACGAGTTTGGCCAGGGCGGCGACGGCGACGAGGCGGCCAAGGCCGAG
GCCACGGAGGAGAAGAAGGAGGAGGAGGAGGAGGAGGAGGCGGCGGAGGAGGAGGGCGGCGCCGGCAACAAGAGC
AAGAGCAAGAGCAAGAGCAAGAGCAAGAGCAAGACAGGGCCGGCGGGCGAGGCGACGGGACGCGATGCCCGACAG
GCGGCGACCCGGCGCCGGTGA
Gene >Hirsu2|2845
ATGCCCTCGTCCTCAGCCGGGCCGGCGGCGGGCCAGCCGCAGCAGCAGGAACAACGAGGAGGCGTAAGTCGGCAC
GATGCGGCCGGAGACGGGCAGAGCCGACGCTGACAGCAGACGCAGGGCTTCAACCTCAACCGGCTGCTGCTCGGC
GGCGCCGTCTACTTCGGCCTCAACTACCTCATGTCGTACGCGATGCAGAAGAACCAGCGGGGCGTGGCCGTGACC
AACCCCGAGACGGGCCAGGTGGTGACGGTGGCCGGCAACACGGACGGCATCCCGCCCTACGAGCTGCGGCCCCGG
ACGCTCGACGAGGGCGCCCAGTACCGGCCGGTGCCGGCCAAGATCGCGCCCATCTGGCCGCAGGACAGCCGGCTC
GACATCGTCGTCACCCTGTCGCCGTCGTTCAGCCCGGCGCCGCTGTCGCAGACGCCGGCCGAGTACGTCGTCCTG
CGCGAGCACGGCTTCCACATGGACAACCGGTCGGACGCGCGCTCCGTCGACACCACCTTCGCCGTGCCGCCGGCC
GTCCAGCGCAACGGCACGCTCTGGGGCCACTTCTACGTCGGCCTCGCCGGCAGCGTCCTCGACCCGCGCCAGCCG
GGCTTCGACCCGGGCGCCGCCTACCACTTCGCCCACCCGCTGACGCAGTACCTGGCCAAGAAGAAGGTGGCCAAG
ACGCGGAACCTGCTCGAGGGCCGCGCCGACGCGGCCGCGGCCGACGCGGCCGACGACCAGCGCGGGCCCGTCATC
GCCAGCCACTACCACCCCAACGCCAGCTTCGCCTTCGTGCCGGCCATGGGCGTCCGGGACTTTTCGCAGCTGCAC
CCGGCCATCAAGCAGTTTCTGCGGCTCGAGGCAACGGGGGCGCGCGACGGCAGCGGCCAAAACGGCTGGTACTGT
CCGTCATCCTCCTCCCTCGGCTGGTCTTGGGCTTATGCTGACCCACGCACGCGCTCCCTCCAGACCCGCTCTTGT
TCGTCAACAACTTCTGGCAGCTGACGAGCCACATGACGGTGCTCAACGAGACGGTCAAGGAGCTGCCGCTGCACA
TCGAGCTCAAGAACATGGCGTTTTGGCAGTTCCAGCTGCTGGCGTCGATCGAGATGAACTCCAAGGAGAACGCGC
GGCAGGCGGCGCACGGGGCGTCGCTGCCCGGTGGCGGCGACGGAACCGAGATCGAGATGGTCAAGGAGATCTTTA
TCGACACCAACCCGATCCTGCTGGCCATCACGGCCGTGGTGACGGTGGCGCACCTGATCCTCGAGACGTTGGCCT
TTGGGTCGGACATTGCGCACTACCGCAAGAAGAAGGACAACGTCGGCATCTCGGTGCGGTCGATCCTGGCCAACG
TGGTGATGCAGGCCATCATCTTCCTGTACCTGCTCGACAACTCGCAGAACACGAGCTGGATGATCCTGGGGACGC
AGGTGGTGGGCATCGTCATCGAGTTGTGGAAAATAACGACGGTCGTCGACGTGCGGGTGCGGCCGGCGCCGGCCG
GATCGCTGCTGCCGTGGCGGCTGGCGATGGAGGACAAGCACACGCTGACGGAGACGGAGGAGAAGACGAAGGAGT
ACGACGAGATCGCGTTCCGGTACATGTACATGGCGGCGGTGCCGCTGCTGGTGGCGTACGGGGCCTACTCGCTGG
TGTACGAGTCGCACAAGTCGTGGTACTCGTTCGTCATCACGACGCTGGTCGGGTCCGTCTACACGTACGGCTTCC
TGATGATGGTGCCGTCGCTCTACATCAACTACCGGCTCAAGAGCGTGGCGCACATGCCGGCCAAGGCGATGATGT
ACAAGTTCCTCAACACCTTCATCGACGACCTGTTCGCCTTCACCATCAAGATGCCGATCCTGCACCGGCTGGCGA
CGTTCCGCGACGACGTCATCTTCTTCGTCTACCTGTACCAGAAGTGGGCGTACCGGACCGACTACACGCGCGTCA
ACGAGTTTGGCCAGGGCGGCGACGGCGACGAGGCGGCCAAGGCCGAGGCCACGGAGGAGAAGAAGGAGGAGGAGG
AGGAGGAGGAGGCGGCGGAGGAGGAGGGCGGCGCCGGCAACAAGAGCAAGAGCAAGAGCAAGAGCAAGAGCAAGA
GCAAGACAGGGCCGGCGGGCGAGGCGACGGGACGCGATGCCCGACAGGCGGCGACCCGGCGCCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail