Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2827
Gene name
LocationContig_17:51189..51603
Strand+
Gene length (bp)414
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08592 DUF1772 Domain of unknown function (DUF1772) 4.9E-26 1 128

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B8NI03|HYPC_ASPFN Noranthrone monooxygenase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hypC PE=1 SV=1 1 127 6.0E-15
sp|Q9C0W5|YHLE_SCHPO Uncharacterized mitochondrial membrane protein C800.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.14c PE=4 SV=1 18 130 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 57 79 22
3 109 131 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2827
MSLSAFVVPVFLDTHDDANKILQQWACLYLYGRAYLPALCVATCGFYGYIAVSRRRVARWYALAAVSTFAMVPFT
WLAMTPTNNTLFGLAASASPPNLSLVRGLLVRWAWLHVTRSLAPLIGAFVGLASLLRELRVQ*
Coding >Hirsu2|2827
ATGAGCCTGTCGGCATTTGTCGTTCCCGTATTCCTTGACACTCATGACGACGCCAACAAGATTCTCCAACAGTGG
GCATGCCTCTACCTGTACGGCCGAGCGTATTTGCCTGCGCTTTGCGTGGCCACATGCGGGTTCTACGGCTACATC
GCCGTGAGCAGACGGAGGGTCGCGCGGTGGTATGCGTTGGCGGCGGTATCGACCTTTGCCATGGTGCCCTTCACA
TGGCTAGCCATGACGCCCACAAACAACACCCTGTTCGGCCTCGCGGCGTCAGCATCTCCCCCCAACCTGAGCCTT
GTCCGGGGCCTGCTGGTGCGGTGGGCATGGCTGCATGTTACACGGTCCTTGGCTCCGCTTATCGGGGCATTTGTT
GGCCTCGCAAGCCTTTTACGAGAGCTTCGTGTGCAGTAA
Transcript >Hirsu2|2827
ATGAGCCTGTCGGCATTTGTCGTTCCCGTATTCCTTGACACTCATGACGACGCCAACAAGATTCTCCAACAGTGG
GCATGCCTCTACCTGTACGGCCGAGCGTATTTGCCTGCGCTTTGCGTGGCCACATGCGGGTTCTACGGCTACATC
GCCGTGAGCAGACGGAGGGTCGCGCGGTGGTATGCGTTGGCGGCGGTATCGACCTTTGCCATGGTGCCCTTCACA
TGGCTAGCCATGACGCCCACAAACAACACCCTGTTCGGCCTCGCGGCGTCAGCATCTCCCCCCAACCTGAGCCTT
GTCCGGGGCCTGCTGGTGCGGTGGGCATGGCTGCATGTTACACGGTCCTTGGCTCCGCTTATCGGGGCATTTGTT
GGCCTCGCAAGCCTTTTACGAGAGCTTCGTGTGCAGTAA
Gene >Hirsu2|2827
ATGAGCCTGTCGGCATTTGTCGTTCCCGTATTCCTTGACACTCATGACGACGCCAACAAGATTCTCCAACAGTGG
GCATGCCTCTACCTGTACGGCCGAGCGTATTTGCCTGCGCTTTGCGTGGCCACATGCGGGTTCTACGGCTACATC
GCCGTGAGCAGACGGAGGGTCGCGCGGTGGTATGCGTTGGCGGCGGTATCGACCTTTGCCATGGTGCCCTTCACA
TGGCTAGCCATGACGCCCACAAACAACACCCTGTTCGGCCTCGCGGCGTCAGCATCTCCCCCCAACCTGAGCCTT
GTCCGGGGCCTGCTGGTGCGGTGGGCATGGCTGCATGTTACACGGTCCTTGGCTCCGCTTATCGGGGCATTTGTT
GGCCTCGCAAGCCTTTTACGAGAGCTTCGTGTGCAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail