Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2825
Gene name
LocationContig_17:48093..49473
Strand+
Gene length (bp)1380
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14027 Questin_oxidase Questin oxidase-like 8.0E-87 49 380

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6UEF1|AFLY_ASPPA Oxidoreductase AflY OS=Aspergillus parasiticus GN=aflY PE=4 SV=1 24 440 2.0E-77

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6885 0.1499 0.1183 0.0695 0.0772 0.0736 0.2237 0.3616 0.4426 0.4787

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup405
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6941
Ophiocordyceps australis map64 (Brazil) OphauB2|5850
Ophiocordyceps camponoti-floridani Ophcf2|04830
Ophiocordyceps camponoti-rufipedis Ophun1|5854
Ophiocordyceps kimflemingae Ophio5|5164
Ophiocordyceps kimflemingae Ophio5|682
Ophiocordyceps subramaniannii Hirsu2|2221
Ophiocordyceps subramaniannii Hirsu2|2825 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2825
MAEAFVLPSENLGLGRIDASPAGSSDVIRSLLQRNHEKWHMYFRDVAGHNHIPHAVLTTLAMGGGPQELRRAYDD
GEAIQRPMPPLDPVVVSELSDPAKFRQHMQVLDKYPSFLAFFEHEIEAKGSWQAVINEHCFRRTPLADFMLAQLF
EGLYHPIIHLGFGIEFELPGIVAEGLAQAASHDPMYIDVFFQKAEELARQAGPPRRPLVELYREVRANDKIRTAA
RLPDGPWKVRDGVLGRAMEDIVRVAAQFQVEPTDRDVERATAEMISCAAWTCGGVQKPGKERKIDFFLMHNVTSS
IFLTVMGRQPWIRLKDKARLIEYKARMDLVWYAASAAPEILDENILNYEPTTSKGMDWGKLYETMNRHHDDGHVA
KFVRAIKNGEEVTLPFEKGQVKGTDEDRIDGTTDFLPVRGDMWFRIAQMCYDSVHTYVDGKKKWVWGAGFDPMWD
AVRDSSNMN*
Coding >Hirsu2|2825
ATGGCAGAAGCTTTCGTCTTGCCGTCGGAAAACCTTGGCCTGGGGCGAATCGATGCCAGTCCAGCAGGCTCATCC
GATGTAATCCGCAGCCTGCTGCAACGGAACCACGAGAAATGGCATATGTATTTCCGGGATGTTGCCGGCCACAAC
CATATCCCTCATGCCGTTCTGACCACTCTGGCCATGGGAGGCGGGCCGCAGGAGCTGAGGAGGGCGTACGACGAC
GGCGAAGCCATCCAGCGTCCTATGCCCCCGCTGGACCCTGTGGTCGTCAGTGAGCTGAGCGACCCAGCCAAGTTC
AGGCAGCACATGCAGGTGCTCGACAAGTATCCAAGCTTCCTGGCCTTCTTTGAACATGAGATAGAGGCCAAGGGC
AGCTGGCAGGCCGTCATCAACGAGCACTGCTTTAGGCGGACGCCGCTCGCCGACTTCATGCTGGCCCAGCTATTC
GAAGGCCTATACCACCCGATCATACACCTGGGCTTCGGCATCGAGTTCGAGCTACCGGGCATCGTGGCTGAGGGA
CTGGCTCAAGCAGCGAGCCACGACCCTATGTACATAGACGTCTTTTTCCAGAAGGCCGAGGAGCTCGCCAGGCAG
GCCGGGCCCCCTCGCCGGCCTCTTGTCGAGCTGTATCGCGAAGTACGCGCCAACGACAAAATCCGTACCGCCGCG
CGCCTGCCTGACGGACCCTGGAAGGTTCGTGACGGCGTGCTGGGCCGTGCCATGGAGGACATCGTTCGAGTGGCC
GCGCAGTTTCAAGTAGAGCCCACGGACCGCGACGTGGAGCGCGCCACGGCCGAGATGATCAGCTGCGCAGCCTGG
ACGTGTGGTGGGGTCCAGAAGCCGGGCAAGGAACGAAAGATTGACTTCTTTCTTATGCACAACGTCACGAGCTCC
ATCTTTCTCACAGTCATGGGTCGACAGCCGTGGATCCGCCTGAAAGACAAAGCTCGCCTGATCGAATACAAAGCC
CGTATGGACCTTGTTTGGTATGCGGCCAGTGCTGCGCCAGAGATTCTGGATGAAAACATCCTGAACTACGAACCA
ACCACGAGCAAGGGCATGGACTGGGGCAAGCTGTACGAGACTATGAATCGACATCATGACGACGGACACGTCGCC
AAGTTCGTGCGCGCCATCAAGAACGGCGAGGAAGTCACTTTGCCGTTCGAGAAGGGGCAAGTCAAGGGTACCGAT
GAAGACCGCATAGACGGAACGACCGACTTTCTTCCTGTCAGAGGAGACATGTGGTTCAGGATTGCGCAGATGTGC
TACGATTCCGTTCACACGTACGTTGACGGCAAGAAAAAATGGGTTTGGGGCGCTGGCTTCGACCCCATGTGGGAC
GCCGTTAGAGACAGCAGCAACATGAACTAA
Transcript >Hirsu2|2825
ATGGCAGAAGCTTTCGTCTTGCCGTCGGAAAACCTTGGCCTGGGGCGAATCGATGCCAGTCCAGCAGGCTCATCC
GATGTAATCCGCAGCCTGCTGCAACGGAACCACGAGAAATGGCATATGTATTTCCGGGATGTTGCCGGCCACAAC
CATATCCCTCATGCCGTTCTGACCACTCTGGCCATGGGAGGCGGGCCGCAGGAGCTGAGGAGGGCGTACGACGAC
GGCGAAGCCATCCAGCGTCCTATGCCCCCGCTGGACCCTGTGGTCGTCAGTGAGCTGAGCGACCCAGCCAAGTTC
AGGCAGCACATGCAGGTGCTCGACAAGTATCCAAGCTTCCTGGCCTTCTTTGAACATGAGATAGAGGCCAAGGGC
AGCTGGCAGGCCGTCATCAACGAGCACTGCTTTAGGCGGACGCCGCTCGCCGACTTCATGCTGGCCCAGCTATTC
GAAGGCCTATACCACCCGATCATACACCTGGGCTTCGGCATCGAGTTCGAGCTACCGGGCATCGTGGCTGAGGGA
CTGGCTCAAGCAGCGAGCCACGACCCTATGTACATAGACGTCTTTTTCCAGAAGGCCGAGGAGCTCGCCAGGCAG
GCCGGGCCCCCTCGCCGGCCTCTTGTCGAGCTGTATCGCGAAGTACGCGCCAACGACAAAATCCGTACCGCCGCG
CGCCTGCCTGACGGACCCTGGAAGGTTCGTGACGGCGTGCTGGGCCGTGCCATGGAGGACATCGTTCGAGTGGCC
GCGCAGTTTCAAGTAGAGCCCACGGACCGCGACGTGGAGCGCGCCACGGCCGAGATGATCAGCTGCGCAGCCTGG
ACGTGTGGTGGGGTCCAGAAGCCGGGCAAGGAACGAAAGATTGACTTCTTTCTTATGCACAACGTCACGAGCTCC
ATCTTTCTCACAGTCATGGGTCGACAGCCGTGGATCCGCCTGAAAGACAAAGCTCGCCTGATCGAATACAAAGCC
CGTATGGACCTTGTTTGGTATGCGGCCAGTGCTGCGCCAGAGATTCTGGATGAAAACATCCTGAACTACGAACCA
ACCACGAGCAAGGGCATGGACTGGGGCAAGCTGTACGAGACTATGAATCGACATCATGACGACGGACACGTCGCC
AAGTTCGTGCGCGCCATCAAGAACGGCGAGGAAGTCACTTTGCCGTTCGAGAAGGGGCAAGTCAAGGGTACCGAT
GAAGACCGCATAGACGGAACGACCGACTTTCTTCCTGTCAGAGGAGACATGTGGTTCAGGATTGCGCAGATGTGC
TACGATTCCGTTCACACGTACGTTGACGGCAAGAAAAAATGGGTTTGGGGCGCTGGCTTCGACCCCATGTGGGAC
GCCGTTAGAGACAGCAGCAACATGAACTAA
Gene >Hirsu2|2825
ATGGCAGAAGCTTTCGTCTTGCCGTCGGAAAACCTTGGCCTGGGGCGAATCGATGCCAGTCCAGCAGGCTCATCC
GATGTAATCCGCAGCCTGCTGCAACGGAACCACGAGAAATGGCATATGTATTTCCGGGATGTTGCCGGCCACAAC
CATATCCCTCATGCCGTTCTGACCACTCTGGCCATGGGAGGCGGGCCGCAGGAGCTGAGGAGGGCGTACGACGAC
GGCGAAGCCATCCAGCGTCCTATGCCCCCGCTGGACCCTGTGGTCGTCAGTGAGCTGAGCGACCCAGCCAAGTTC
AGGCAGCACATGCAGGTGCTCGACAAGTATCCAAGCTTCCTGGCCTTCTTTGAACATGAGATAGAGGCCAAGGGC
AGCTGGCAGGCCGTCATCAACGAGCACTGCTTTAGGCGGACGCCGCTCGCCGACTTCATGCTGGCCCAGCTATTC
GAAGGCCTATACCACCCGATCATACACCTGGGCTTCGGCATCGAGTTCGAGCTACCGGGCATCGTGGCTGAGGGA
CTGGCTCAAGCAGCGAGCCACGACCCTATGTACATAGACGTCTTTTTCCAGAAGGCCGAGGAGCTCGCCAGGCAG
GCCGGGCCCCCTCGCCGGCCTCTTGTCGAGCTGTATCGCGAAGTACGCGCCAACGACAAAATCCGTACCGCCGCG
CGCCTGCCTGACGGACCCTGGAAGGTTCGTGACGGCGTGCTGGGCCGTGCCATGGAGGACATCGTTCGAGTGGCC
GCGCAGTTTCAAGTAGAGCCCACGGACCGCGACGTGGAGCGCGCCACGGCCGAGATGATCAGCTGCGCAGCCTGG
ACGTGTGGTGGGGTCCAGAAGCCGGGCAAGGAACGAAAGATTGACTTCTTTCTTATGCACAACGTCACGAGCTCC
ATCTTTCTCACAGTCATGGGTCGACAGCCGTGGATCCGCCTGAAAGACAAAGCTCGCCTGATCGAATACAAAGCC
CGTATGGACCTTGTTTGGTATGCGGCCAGTGCTGCGCCAGAGATTCTGGATGAAAACATCCTGAACTACGAACCA
ACCACGAGCAAGGGCATGGACTGGGGCAAGCTGTACGAGACTATGAATCGACATCATGACGACGGACACGTCGCC
AAGTTCGTGCGCGCCATCAAGAACGGCGAGGAAGTCACTTTGCCGTTCGAGAAGGGGCAAGTCAAGGGTACCGAT
GAAGACCGCATAGACGGAACGACCGACTTTCTTCCTGTCAGAGGAGACATGTGGTTCAGGATTGCGCAGATGTGC
TACGATTCCGTTCACACGTACGTTGACGGCAAGAAAAAATGGGTTTGGGGCGCTGGCTTCGACCCCATGTGGGAC
GCCGTTAGAGACAGCAGCAACATGAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail