Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2824
Gene name
LocationContig_17:45911..46832
Strand-
Gene length (bp)921
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 6.5E-12 47 139
PF08241 Methyltransf_11 Methyltransferase domain 4.6E-11 49 142
PF08242 Methyltransf_12 Methyltransferase domain 3.2E-08 49 140
PF13847 Methyltransf_31 Methyltransferase domain 3.4E-07 47 147

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P65349|Y3374_MYCBO Uncharacterized methyltransferase Mb3374 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3374 PE=3 SV=1 18 141 3.0E-07
sp|P9WK01|Y3342_MYCTU Uncharacterized methyltransferase Rv3342 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3342 PE=1 SV=1 18 141 3.0E-07
sp|P9WK00|Y3342_MYCTO Uncharacterized methyltransferase MT3445 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3445 PE=3 SV=1 18 141 3.0E-07

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2824
MSSNGEIFAQDDEFWINYLKGRPQVPDSLFDRVFGYHQAKGGAFDVVHDVGAGNGPYSQKLRSRFMHVIVSDVVP
ENIELARQRLGATEGFTFRAAELRKTDDIPAGSVDMVFAANMMHFPDPQEAAMTAVAHQLRSGGTFVAAAFGPAR
FCDARMQDLWARISHEGGRQLLKADEDPAQTIRVMARTQDTYNVAPLDPSLFAPGAQRIHLNMGQGGVQGMLPPE
EAHRNTEPDYTSPSDVVVHEVDEGWSFEKDLAGVKEHFASFPFVSKFPDTFKDLYEELDKLAVGEPFRGYYPVKV
ILATRR*
Coding >Hirsu2|2824
ATGAGTTCAAACGGCGAGATATTTGCACAGGACGATGAGTTCTGGATTAACTACCTCAAGGGCAGACCGCAAGTT
CCAGACTCCCTTTTCGACCGTGTCTTTGGCTACCACCAAGCCAAGGGTGGAGCTTTTGATGTCGTCCACGACGTC
GGTGCTGGAAACGGGCCCTACTCTCAAAAGTTGCGGTCGCGGTTCATGCACGTCATCGTCTCCGATGTTGTGCCC
GAAAACATCGAGCTAGCTCGCCAGCGCCTCGGGGCCACCGAGGGCTTCACCTTCCGCGCCGCCGAGCTTCGCAAG
ACCGATGACATCCCTGCTGGCTCCGTGGACATGGTCTTTGCCGCCAATATGATGCACTTCCCAGATCCCCAGGAG
GCCGCTATGACAGCCGTCGCGCACCAGCTGAGATCAGGAGGCACGTTCGTCGCCGCCGCTTTTGGCCCGGCTCGA
TTCTGCGACGCCAGGATGCAGGATCTCTGGGCTCGTATCAGCCACGAGGGCGGTCGTCAGCTCCTGAAGGCGGAC
GAGGATCCAGCCCAGACCATCCGGGTCATGGCGAGGACTCAAGACACCTACAACGTGGCTCCCCTTGACCCATCG
CTCTTCGCGCCCGGGGCGCAGCGCATTCACCTAAATATGGGTCAAGGTGGCGTCCAGGGTATGCTACCACCGGAA
GAAGCGCACCGTAACACAGAGCCTGATTACACTAGCCCGAGCGACGTCGTGGTTCACGAGGTCGACGAGGGATGG
AGCTTTGAAAAGGACTTGGCGGGCGTCAAAGAGCACTTCGCCTCGTTCCCCTTCGTTTCTAAATTTCCTGACACC
TTTAAAGACTTATACGAGGAGCTGGATAAGCTCGCAGTTGGGGAGCCTTTTCGAGGCTACTATCCTGTCAAAGTA
ATCTTGGCGACACGTCGATAA
Transcript >Hirsu2|2824
ATGAGTTCAAACGGCGAGATATTTGCACAGGACGATGAGTTCTGGATTAACTACCTCAAGGGCAGACCGCAAGTT
CCAGACTCCCTTTTCGACCGTGTCTTTGGCTACCACCAAGCCAAGGGTGGAGCTTTTGATGTCGTCCACGACGTC
GGTGCTGGAAACGGGCCCTACTCTCAAAAGTTGCGGTCGCGGTTCATGCACGTCATCGTCTCCGATGTTGTGCCC
GAAAACATCGAGCTAGCTCGCCAGCGCCTCGGGGCCACCGAGGGCTTCACCTTCCGCGCCGCCGAGCTTCGCAAG
ACCGATGACATCCCTGCTGGCTCCGTGGACATGGTCTTTGCCGCCAATATGATGCACTTCCCAGATCCCCAGGAG
GCCGCTATGACAGCCGTCGCGCACCAGCTGAGATCAGGAGGCACGTTCGTCGCCGCCGCTTTTGGCCCGGCTCGA
TTCTGCGACGCCAGGATGCAGGATCTCTGGGCTCGTATCAGCCACGAGGGCGGTCGTCAGCTCCTGAAGGCGGAC
GAGGATCCAGCCCAGACCATCCGGGTCATGGCGAGGACTCAAGACACCTACAACGTGGCTCCCCTTGACCCATCG
CTCTTCGCGCCCGGGGCGCAGCGCATTCACCTAAATATGGGTCAAGGTGGCGTCCAGGGTATGCTACCACCGGAA
GAAGCGCACCGTAACACAGAGCCTGATTACACTAGCCCGAGCGACGTCGTGGTTCACGAGGTCGACGAGGGATGG
AGCTTTGAAAAGGACTTGGCGGGCGTCAAAGAGCACTTCGCCTCGTTCCCCTTCGTTTCTAAATTTCCTGACACC
TTTAAAGACTTATACGAGGAGCTGGATAAGCTCGCAGTTGGGGAGCCTTTTCGAGGCTACTATCCTGTCAAAGTA
ATCTTGGCGACACGTCGATAA
Gene >Hirsu2|2824
ATGAGTTCAAACGGCGAGATATTTGCACAGGACGATGAGTTCTGGATTAACTACCTCAAGGGCAGACCGCAAGTT
CCAGACTCCCTTTTCGACCGTGTCTTTGGCTACCACCAAGCCAAGGGTGGAGCTTTTGATGTCGTCCACGACGTC
GGTGCTGGAAACGGGCCCTACTCTCAAAAGTTGCGGTCGCGGTTCATGCACGTCATCGTCTCCGATGTTGTGCCC
GAAAACATCGAGCTAGCTCGCCAGCGCCTCGGGGCCACCGAGGGCTTCACCTTCCGCGCCGCCGAGCTTCGCAAG
ACCGATGACATCCCTGCTGGCTCCGTGGACATGGTCTTTGCCGCCAATATGATGCACTTCCCAGATCCCCAGGAG
GCCGCTATGACAGCCGTCGCGCACCAGCTGAGATCAGGAGGCACGTTCGTCGCCGCCGCTTTTGGCCCGGCTCGA
TTCTGCGACGCCAGGATGCAGGATCTCTGGGCTCGTATCAGCCACGAGGGCGGTCGTCAGCTCCTGAAGGCGGAC
GAGGATCCAGCCCAGACCATCCGGGTCATGGCGAGGACTCAAGACACCTACAACGTGGCTCCCCTTGACCCATCG
CTCTTCGCGCCCGGGGCGCAGCGCATTCACCTAAATATGGGTCAAGGTGGCGTCCAGGGTATGCTACCACCGGAA
GAAGCGCACCGTAACACAGAGCCTGATTACACTAGCCCGAGCGACGTCGTGGTTCACGAGGTCGACGAGGGATGG
AGCTTTGAAAAGGACTTGGCGGGCGTCAAAGAGCACTTCGCCTCGTTCCCCTTCGTTTCTAAATTTCCTGACACC
TTTAAAGACTTATACGAGGAGCTGGATAAGCTCGCAGTTGGGGAGCCTTTTCGAGGCTACTATCCTGTCAAAGTA
ATCTTGGCGACACGTCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail