Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2823
Gene name
LocationContig_17:43232..44045
Strand-
Gene length (bp)813
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 1.8E-14 13 218
PF05368 NmrA NmrA-like family 3.0E-05 10 98

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6UEF2|AFLX_ASPPA Oxidoreductase AflX OS=Aspergillus parasiticus GN=aflX PE=3 SV=1 9 270 3.0E-71
sp|Q00713|STCQ_EMENI Averufin oxidase A homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcQ PE=3 SV=1 8 263 3.0E-63
sp|Q12437|AVFA_ASPPA Averufin oxidase A OS=Aspergillus parasiticus GN=avfA PE=2 SV=2 8 220 7.0E-16
sp|Q9P8Z9|AVFA_ASPFL Averufin oxidase A OS=Aspergillus flavus GN=avfA PE=3 SV=1 8 214 2.0E-13
sp|Q00710|STCO_EMENI Averufin oxidase A homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcO PE=3 SV=1 8 220 1.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2823
MTVHVNNTYAVLGATGNCGTALIKNLLQKPNAGIKAYCRDRSKLVGLLPEIERDGRVEIFQGSIQDIDLLASCIH
GCRAVFLVVSTNDNIPGCRVAQDTAAAVIQALRNLGGISHDHGATPTPKLVLLSSATIDNHLSRHVPYLLRLILL
RSASHVYRDLVETETLLRGQEDWLTSIYIKPGALSVDIQRGHALSFTDEDSPLSYLDLAAAMIEAVDDEDGRYDL
KNVSVVNATAKAGFPKGTPLCILMGLLRHFFPFLHPYLPMNTGPR*
Coding >Hirsu2|2823
ATGACTGTTCATGTCAACAATACCTATGCCGTCTTGGGCGCCACAGGAAACTGCGGTACTGCCCTCATCAAAAAC
CTCTTACAGAAACCAAACGCTGGCATCAAGGCCTACTGTCGCGATCGTTCCAAGCTTGTTGGGCTACTTCCCGAA
ATCGAGCGGGACGGGCGGGTCGAGATTTTCCAAGGCAGTATCCAGGACATCGATCTTCTGGCCTCGTGCATTCAC
GGCTGCCGAGCCGTTTTCCTCGTCGTCTCGACCAACGACAACATCCCGGGCTGCCGCGTGGCCCAAGACACGGCC
GCAGCCGTGATTCAGGCGCTCCGGAACCTCGGAGGCATCTCACACGACCATGGTGCCACACCCACACCAAAGCTC
GTGCTTCTATCGTCTGCCACCATCGATAACCATCTCTCTCGCCACGTTCCCTACCTCTTGCGACTGATCCTATTG
CGGTCGGCATCTCACGTCTATCGTGACCTGGTGGAAACAGAAACGTTGCTCCGTGGACAGGAGGACTGGCTCACT
TCAATTTACATTAAGCCTGGCGCATTATCGGTCGACATACAGCGAGGCCATGCCTTGAGCTTTACCGACGAGGAT
AGCCCTTTGTCCTACCTGGACCTGGCGGCTGCCATGATAGAGGCGGTCGATGACGAGGACGGGCGCTACGATCTC
AAGAACGTGAGTGTGGTCAACGCGACTGCCAAGGCAGGTTTTCCGAAGGGCACGCCCCTGTGCATCCTGATGGGT
CTTCTCAGACATTTCTTCCCATTTCTACACCCGTACTTGCCGATGAACACCGGACCACGATGA
Transcript >Hirsu2|2823
ATGACTGTTCATGTCAACAATACCTATGCCGTCTTGGGCGCCACAGGAAACTGCGGTACTGCCCTCATCAAAAAC
CTCTTACAGAAACCAAACGCTGGCATCAAGGCCTACTGTCGCGATCGTTCCAAGCTTGTTGGGCTACTTCCCGAA
ATCGAGCGGGACGGGCGGGTCGAGATTTTCCAAGGCAGTATCCAGGACATCGATCTTCTGGCCTCGTGCATTCAC
GGCTGCCGAGCCGTTTTCCTCGTCGTCTCGACCAACGACAACATCCCGGGCTGCCGCGTGGCCCAAGACACGGCC
GCAGCCGTGATTCAGGCGCTCCGGAACCTCGGAGGCATCTCACACGACCATGGTGCCACACCCACACCAAAGCTC
GTGCTTCTATCGTCTGCCACCATCGATAACCATCTCTCTCGCCACGTTCCCTACCTCTTGCGACTGATCCTATTG
CGGTCGGCATCTCACGTCTATCGTGACCTGGTGGAAACAGAAACGTTGCTCCGTGGACAGGAGGACTGGCTCACT
TCAATTTACATTAAGCCTGGCGCATTATCGGTCGACATACAGCGAGGCCATGCCTTGAGCTTTACCGACGAGGAT
AGCCCTTTGTCCTACCTGGACCTGGCGGCTGCCATGATAGAGGCGGTCGATGACGAGGACGGGCGCTACGATCTC
AAGAACGTGAGTGTGGTCAACGCGACTGCCAAGGCAGGTTTTCCGAAGGGCACGCCCCTGTGCATCCTGATGGGT
CTTCTCAGACATTTCTTCCCATTTCTACACCCGTACTTGCCGATGAACACCGGACCACGATGA
Gene >Hirsu2|2823
ATGACTGTTCATGTCAACAATACCTATGCCGTCTTGGGCGCCACAGGAAACTGCGGTACTGCCCTCATCAAAAAC
CTCTTACAGAAACCAAACGCTGGCATCAAGGCCTACTGTCGCGATCGTTCCAAGCTTGTTGGGCTACTTCCCGAA
ATCGAGCGGGACGGGCGGGTCGAGATTTTCCAAGGCAGTATCCAGGACATCGATCTTCTGGCCTCGTGCATTCAC
GGCTGCCGAGCCGTTTTCCTCGTCGTCTCGACCAACGACAACATCCCGGGCTGCCGCGTGGCCCAAGACACGGCC
GCAGCCGTGATTCAGGCGCTCCGGAACCTCGGAGGCATCTCACACGACCATGGTGCCACACCCACACCAAAGCTC
GTGCTTCTATCGTCTGCCACCATCGATAACCATCTCTCTCGCCACGTTCCCTACCTCTTGCGACTGATCCTATTG
CGGTCGGCATCTCACGTCTATCGTGACCTGGTGGAAACAGAAACGTTGCTCCGTGGACAGGAGGACTGGCTCACT
TCAATTTACATTAAGCCTGGCGCATTATCGGTCGACATACAGCGAGGCCATGCCTTGAGCTTTACCGACGAGGAT
AGCCCTTTGTCCTACCTGGACCTGGCGGCTGCCATGATAGAGGCGGTCGATGACGAGGACGGGCGCTACGATCTC
AAGAACGTGAGTGTGGTCAACGCGACTGCCAAGGCAGGTTTTCCGAAGGGCACGCCCCTGTGCATCCTGATGGGT
CTTCTCAGACATTTCTTCCCATTTCTACACCCGTACTTGCCGATGAACACCGGACCACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail