Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2814
Gene name
LocationContig_1699:2739..4695
Strand+
Gene length (bp)1956
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain 2.9E-22 306 518
PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain 1.2E-12 141 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WUV8|XKS1_ASPFU Probable D-xylulose kinase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|B0Y4D5|XKS1_ASPFC Probable D-xylulose kinase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|Q8X167|XKS1_ASPNG D-xylulose kinase A OS=Aspergillus niger GN=xkiA PE=1 SV=1 8 574 0.0E+00
sp|A2QMS4|XKS1_ASPNC Probable D-xylulose kinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|A1CAU3|XKS1_ASPCL Probable D-xylulose kinase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xkiA PE=2 SV=1 8 574 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WUV8|XKS1_ASPFU Probable D-xylulose kinase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|B0Y4D5|XKS1_ASPFC Probable D-xylulose kinase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|Q8X167|XKS1_ASPNG D-xylulose kinase A OS=Aspergillus niger GN=xkiA PE=1 SV=1 8 574 0.0E+00
sp|A2QMS4|XKS1_ASPNC Probable D-xylulose kinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|A1CAU3|XKS1_ASPCL Probable D-xylulose kinase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|Q0CIL2|XKS1_ASPTN Probable D-xylulose kinase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xkiA PE=2 SV=1 1 575 0.0E+00
sp|C5FSW4|XKS1_ARTOC Probable D-xylulose kinase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xkiA PE=2 SV=1 8 575 0.0E+00
sp|Q2U3V4|XKS1_ASPOR Probable D-xylulose kinase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|Q5ASE0|XKS1_EMENI Probable D-xylulose kinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xkiA PE=2 SV=1 2 574 0.0E+00
sp|B8NTI4|XKS1_ASPFN Probable D-xylulose kinase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|A1DEK3|XKS1_NEOFI Probable D-xylulose kinase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xkiA PE=2 SV=1 8 574 0.0E+00
sp|Q9C0U6|XKS1_SCHPO Xylulose kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=xks1 PE=3 SV=1 10 567 1.0E-155
sp|P42826|XKS1_YEAST Xylulose kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XKS1 PE=1 SV=2 11 571 3.0E-135
sp|Q3SYZ6|XYLB_BOVIN Xylulose kinase OS=Bos taurus GN=XYLB PE=2 SV=1 12 516 1.0E-96
sp|Q3TNA1|XYLB_MOUSE Xylulose kinase OS=Mus musculus GN=Xylb PE=1 SV=1 12 572 7.0E-96
sp|Q3MIF4|XYLB_RAT Xylulose kinase OS=Rattus norvegicus GN=Xylb PE=2 SV=1 12 576 8.0E-94
sp|O75191|XYLB_HUMAN Xylulose kinase OS=Homo sapiens GN=XYLB PE=1 SV=3 12 576 3.0E-93
sp|Q5R830|XYLB_PONAB Xylulose kinase OS=Pongo abelii GN=XYLB PE=2 SV=1 12 516 1.0E-92
sp|P30646|YNE7_CAEEL Uncharacterized sugar kinase R08D7.7 OS=Caenorhabditis elegans GN=R08D7.7 PE=3 SV=4 11 527 1.0E-89
sp|Q9RK00|XYLB_STRCO Xylulose kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=xylB PE=3 SV=2 1 361 8.0E-13
sp|P27156|XYLB_STRRU Xylulose kinase OS=Streptomyces rubiginosus GN=xylB PE=3 SV=1 1 357 6.0E-10
sp|Q49V87|ARAB2_STAS1 Ribulokinase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=araB2 PE=3 SV=1 135 318 5.0E-08
sp|P35850|XYLB_LACBR Xylulose kinase OS=Lactobacillus brevis GN=xylB PE=2 SV=2 8 285 2.0E-06
sp|P12867|XYLB_ACTM4 Xylulose kinase OS=Actinoplanes missouriensis (strain ATCC 14538 / DSM 43046 / CBS 188.64 / JCM 3121 / NCIMB 12654 / NBRC 102363 / 431) GN=xylB PE=3 SV=3 10 486 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2814
MSASDDSGPLYLGFDLSTQQFKAIVVSSDLKTVAQARVDFDDDLGAKYGVRKGVHVREATGEVFAPVAMWLEALD
LVLARLASSSSASVMRRIRAVSGAGQQHGSVFWNARAEACLRGLDPGRALVDQLPAALAHEWSPNWQDQSTQAEC
DAFDAALGDRRTLAEVTGSGAHHRFTGTQIMRLRRLLPDMYAATARISLVSSWLASVLRGAVAPLDVSDVCGMNL
WDMANQRYSRELLALAAGGPNAADDLRGKLGEPVMDGGAALGPVSPYFVVRYGLSPDCQVVPFTGDNPATILALP
LRPLDAIVSLGTSTTFLMNTPAYRPDESYHFFNHPTSAGHYMFMLCYKNGGLAREKVRDQLPGSRGGRRDWDAFN
QAVLRTPPLDMGPGADRAKLGLYFYLRETVPNVRAGTWRFTCRGGDGGDLQPAAEPWPRETDARIITESQALSMR
LRSQKLVHPPRDGLPAQPRRIYLVGGGSPNPAIARVLGDVLGGADGVYRLDVGGNACALGGAYKALWAVERRPGQ
TFDDLIAGRWSEQGSIEEADAGFRPETYGRYGDVLGAFAEMERRLLAEEKGGSG*
Coding >Hirsu2|2814
ATGTCGGCATCGGACGACTCGGGCCCGCTCTACTTGGGCTTCGACCTCTCCACGCAGCAGTTCAAGGCCATCGTC
GTCAGCTCGGACCTCAAGACGGTCGCGCAGGCAAGGGTCGACTTCGACGACGACCTCGGCGCAAAGTATGGCGTC
CGCAAGGGCGTCCACGTGCGCGAAGCGACCGGCGAGGTCTTTGCCCCCGTGGCCATGTGGCTCGAGGCCCTCGAC
CTCGTCCTCGCCCGCCTCGCATCCTCGTCGTCGGCCTCGGTCATGCGCCGCATTCGCGCCGTCAGCGGCGCTGGC
CAGCAGCACGGCAGCGTCTTCTGGAACGCCCGCGCCGAAGCTTGCCTGCGCGGCCTCGATCCGGGCCGCGCCCTC
GTCGACCAGCTGCCCGCCGCTCTGGCCCACGAGTGGTCGCCCAACTGGCAGGACCAGAGCACCCAGGCCGAATGC
GACGCCTTTGACGCCGCCCTCGGCGACAGGCGGACGCTCGCCGAGGTGACGGGCAGCGGCGCCCACCACAGGTTC
ACGGGCACGCAAATCATGCGCCTGCGCCGCCTCCTGCCGGACATGTACGCCGCCACCGCGCGCATCTCTCTCGTC
TCCTCCTGGCTCGCCTCCGTCCTGCGCGGCGCCGTCGCCCCGCTCGACGTCAGCGACGTCTGCGGCATGAACCTC
TGGGACATGGCCAACCAGCGCTACAGCCGCGAGCTGCTGGCCCTGGCCGCCGGCGGCCCCAACGCTGCCGACGAC
CTGCGCGGCAAGCTGGGCGAGCCCGTCATGGACGGCGGCGCCGCCCTCGGCCCCGTCTCGCCCTACTTCGTCGTC
CGCTACGGCCTCAGCCCGGACTGCCAGGTCGTCCCCTTCACGGGCGACAACCCGGCTACCATCCTGGCCCTTCCC
CTGCGGCCCCTCGACGCCATCGTCTCGCTCGGCACCTCGACAACCTTCCTCATGAACACGCCCGCCTACCGGCCC
GACGAGTCGTACCACTTCTTCAACCACCCGACCTCGGCCGGCCACTACATGTTCATGCTCTGCTACAAGAACGGC
GGCCTCGCGCGCGAAAAGGTGCGCGACCAGCTGCCGGGGTCTCGGGGCGGCCGCAGGGACTGGGATGCCTTCAAC
CAGGCCGTCCTGCGCACGCCGCCGCTCGACATGGGCCCCGGCGCGGACAGGGCCAAGCTGGGCCTGTACTTTTAC
CTGCGCGAGACGGTGCCCAACGTCCGCGCCGGCACCTGGCGCTTCACCTGCCGCGGCGGCGACGGCGGCGACCTG
CAGCCGGCAGCGGAGCCCTGGCCCCGGGAGACGGACGCGCGCATCATCACAGAGTCGCAGGCGCTGTCGATGCGG
CTGCGCTCGCAGAAGCTGGTCCACCCGCCGCGCGACGGACTGCCGGCCCAGCCGCGGCGCATCTACCTCGTCGGC
GGCGGCTCGCCGAACCCGGCCATCGCCCGCGTCCTCGGCGACGTGCTGGGCGGCGCCGACGGCGTCTACCGGCTC
GACGTCGGCGGCAACGCCTGCGCCCTCGGCGGCGCCTACAAGGCCCTCTGGGCGGTCGAGCGCCGGCCGGGCCAG
ACGTTCGACGACCTGATCGCCGGCCGCTGGAGCGAGCAGGGCTCGATCGAGGAGGCCGACGCCGGCTTCCGGCCC
GAGACGTACGGCCGGTACGGGGACGTCCTGGGCGCCTTTGCGGAGATGGAGCGGAGGCTGCTGGCGGAGGAGAAG
GGCGGCAGCGGGTGA
Transcript >Hirsu2|2814
ATGTCGGCATCGGACGACTCGGGCCCGCTCTACTTGGGCTTCGACCTCTCCACGCAGCAGTTCAAGGCCATCGTC
GTCAGCTCGGACCTCAAGACGGTCGCGCAGGCAAGGGTCGACTTCGACGACGACCTCGGCGCAAAGTATGGCGTC
CGCAAGGGCGTCCACGTGCGCGAAGCGACCGGCGAGGTCTTTGCCCCCGTGGCCATGTGGCTCGAGGCCCTCGAC
CTCGTCCTCGCCCGCCTCGCATCCTCGTCGTCGGCCTCGGTCATGCGCCGCATTCGCGCCGTCAGCGGCGCTGGC
CAGCAGCACGGCAGCGTCTTCTGGAACGCCCGCGCCGAAGCTTGCCTGCGCGGCCTCGATCCGGGCCGCGCCCTC
GTCGACCAGCTGCCCGCCGCTCTGGCCCACGAGTGGTCGCCCAACTGGCAGGACCAGAGCACCCAGGCCGAATGC
GACGCCTTTGACGCCGCCCTCGGCGACAGGCGGACGCTCGCCGAGGTGACGGGCAGCGGCGCCCACCACAGGTTC
ACGGGCACGCAAATCATGCGCCTGCGCCGCCTCCTGCCGGACATGTACGCCGCCACCGCGCGCATCTCTCTCGTC
TCCTCCTGGCTCGCCTCCGTCCTGCGCGGCGCCGTCGCCCCGCTCGACGTCAGCGACGTCTGCGGCATGAACCTC
TGGGACATGGCCAACCAGCGCTACAGCCGCGAGCTGCTGGCCCTGGCCGCCGGCGGCCCCAACGCTGCCGACGAC
CTGCGCGGCAAGCTGGGCGAGCCCGTCATGGACGGCGGCGCCGCCCTCGGCCCCGTCTCGCCCTACTTCGTCGTC
CGCTACGGCCTCAGCCCGGACTGCCAGGTCGTCCCCTTCACGGGCGACAACCCGGCTACCATCCTGGCCCTTCCC
CTGCGGCCCCTCGACGCCATCGTCTCGCTCGGCACCTCGACAACCTTCCTCATGAACACGCCCGCCTACCGGCCC
GACGAGTCGTACCACTTCTTCAACCACCCGACCTCGGCCGGCCACTACATGTTCATGCTCTGCTACAAGAACGGC
GGCCTCGCGCGCGAAAAGGTGCGCGACCAGCTGCCGGGGTCTCGGGGCGGCCGCAGGGACTGGGATGCCTTCAAC
CAGGCCGTCCTGCGCACGCCGCCGCTCGACATGGGCCCCGGCGCGGACAGGGCCAAGCTGGGCCTGTACTTTTAC
CTGCGCGAGACGGTGCCCAACGTCCGCGCCGGCACCTGGCGCTTCACCTGCCGCGGCGGCGACGGCGGCGACCTG
CAGCCGGCAGCGGAGCCCTGGCCCCGGGAGACGGACGCGCGCATCATCACAGAGTCGCAGGCGCTGTCGATGCGG
CTGCGCTCGCAGAAGCTGGTCCACCCGCCGCGCGACGGACTGCCGGCCCAGCCGCGGCGCATCTACCTCGTCGGC
GGCGGCTCGCCGAACCCGGCCATCGCCCGCGTCCTCGGCGACGTGCTGGGCGGCGCCGACGGCGTCTACCGGCTC
GACGTCGGCGGCAACGCCTGCGCCCTCGGCGGCGCCTACAAGGCCCTCTGGGCGGTCGAGCGCCGGCCGGGCCAG
ACGTTCGACGACCTGATCGCCGGCCGCTGGAGCGAGCAGGGCTCGATCGAGGAGGCCGACGCCGGCTTCCGGCCC
GAGACGTACGGCCGGTACGGGGACGTCCTGGGCGCCTTTGCGGAGATGGAGCGGAGGCTGCTGGCGGAGGAGAAG
GGCGGCAGCGGGTGA
Gene >Hirsu2|2814
ATGTCGGCATCGGACGACTCGGGCCCGCTCTACTTGGGCTTCGACCTCTCCACGCAGCAGTTCAAGGGTACGTCG
GTCCTGCTGGGCGATCGTCTTTCCCCTTGCTCCCATGCCCGATCGAGCCTCGCCACGATGGGCTTCCTCCAATCG
AAGCTCCCTGACCGGTGGCTCATATCCGTCCCCTGATACAAGCCATCGTCGTCAGCTCGGACCTCAAGACGGTCG
CGCAGGCAAGGGTCGACTTCGACGACGACCTCGGCGCAAAGTATGGCGTCCGCAAGGGCGTCCACGTGCGCGAAG
CGACCGGCGAGGTCTTTGCCCCCGTGGCCATGTGGCTCGAGGCCCTCGACCTCGTCCTCGCCCGCCTCGCATCCT
CGTCGTCGGCCTCGGTCATGCGCCGCATTCGCGCCGTCAGCGGCGCTGGCCAGCAGCACGGCAGCGTCTTCTGGA
ACGCCCGCGCCGAAGCTTGCCTGCGCGGCCTCGATCCGGGCCGCGCCCTCGTCGACCAGCTGCCCGCCGCTCTGG
CCCACGAGTGGTCGCCCAACTGGCAGGACCAGAGCACCCAGGCCGAATGCGACGCCTTTGACGCCGCCCTCGGCG
ACAGGCGGACGCTCGCCGAGGTGACGGGCAGCGGCGCCCACCACGTAGGCCGTCTCTCCCCGGCATTTCCCTCTT
CCTCCATCGGAAGTCCGAGCTGACGCCCTTGCCTTTCCCCGTGCCTGTCCCTGTTCGCAGAGGTTCACGGGCACG
CAAATCATGCGCCTGCGCCGCCTCCTGCCGGACATGTACGCCGCCACCGCGCGCATCTCTCTCGTCTCCTCCTGG
CTCGCCTCCGTCCTGCGCGGCGCCGTCGCCCCGCTCGACGTCAGCGACGTCTGCGGCATGAACCTCTGGGACATG
GCCAACCAGCGCTACAGCCGCGAGCTGCTGGCCCTGGCCGCCGGCGGCCCCAACGCTGCCGACGACCTGCGCGGC
AAGCTGGGCGAGCCCGTCATGGACGGCGGCGCCGCCCTCGGCCCCGTCTCGCCCTACTTCGTCGTCCGCTACGGC
CTCAGCCCGGACTGCCAGGTCGTCCCCTTCACGGGCGACAACCCGGCTACCATCCTGGCCCTTCCCCTGCGGCCC
CTCGACGCCATCGTCTCGCTCGGCACCTCGACAACCTTCCTCATGAACACGCCCGCCTACCGGCCCGACGAGTCG
TACCACTTCTTCAACCACCCGACCTCGGCCGGCCACTACATGTTCATGCTCTGCTACAAGAACGGCGGCCTCGCG
CGCGAAAAGGTGCGCGACCAGCTGCCGGGGTCTCGGGGCGGCCGCAGGGACTGGGATGCCTTCAACCAGGCCGTC
CTGCGCACGCCGCCGCTCGACATGGGCCCCGGCGCGGACAGGGCCAAGCTGGGCCTGTACTTTTACCTGCGCGAG
ACGGTGCCCAACGTCCGCGCCGGCACCTGGCGCTTCACCTGCCGCGGCGGCGACGGCGGCGACCTGCAGCCGGCA
GCGGAGCCCTGGCCCCGGGAGACGGACGCGCGCATCATCACAGAGTCGCAGGCGCTGTCGATGCGGCTGCGCTCG
CAGAAGCTGGTCCACCCGCCGCGCGACGGACTGCCGGCCCAGCCGCGGCGCATCTACCTCGTCGGCGGCGGCTCG
CCGAACCCGGCCATCGCCCGCGTCCTCGGCGACGTGCTGGGCGGCGCCGACGGCGTCTACCGGCTCGACGTCGGC
GGCAACGCCTGCGCCCTCGGCGGCGCCTACAAGGCCCTCTGGGCGGTCGAGCGCCGGCCGGGCCAGACGTTCGAC
GACCTGATCGCCGGCCGCTGGAGCGAGCAGGGCTCGATCGAGGAGGCCGACGCCGGCTTCCGGCCCGAGACGTAC
GGCCGGTACGGGGACGTCCTGGGCGCCTTTGCGGAGATGGAGCGGAGGCTGCTGGCGGAGGAGAAGGGCGGCAGC
GGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail