Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2813
Gene name
LocationContig_1699:1231..1909
Strand+
Gene length (bp)678
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 8.6E-14 2 72

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03218|MMT1_YEAST Mitochondrial metal transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT1 PE=1 SV=1 2 159 1.0E-14
sp|O59758|YJM3_SCHPO Uncharacterized metal transporter C1020.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.03 PE=3 SV=1 3 144 2.0E-14
sp|Q08970|MMT2_YEAST Mitochondrial metal transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT2 PE=3 SV=2 2 159 1.0E-13
sp|Q10LJ2|MTP2_ORYSJ Metal tolerance protein 2 OS=Oryza sativa subsp. japonica GN=MTP2 PE=2 SV=1 9 144 1.0E-08
sp|Q8L725|MTPC1_ARATH Metal tolerance protein C1 OS=Arabidopsis thaliana GN=MTPC1 PE=2 SV=1 9 160 5.0E-08

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0006811 ion transport No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2813
MKIARERKSSVLASNAIHHRVDSLTGIVTLAAILGANVFDNAAWLDPVGGLLISLMVIKAGVDNTKASLCELADQ
SIDGDIKAAVRKQTQRALANVGEGHEAELREVSGIKSGQNYLIDLEMAVPGAWTVESVRELEDGVRAQVGGRVRG
VRRVRVRFVPRDAPGRDRFDDFIPGSVHVEADPEEPKESQVDGSGHGSGNDHGSGNGSSCNGSAHRGRQQDRHRH
*
Coding >Hirsu2|2813
ATGAAGATTGCGCGCGAACGCAAGTCGTCGGTGCTGGCGTCCAACGCGATCCACCACCGCGTCGACAGCCTGACG
GGCATCGTGACGCTGGCGGCCATCCTGGGCGCCAACGTCTTCGACAACGCCGCCTGGCTGGACCCGGTGGGCGGG
CTGCTCATCTCGCTCATGGTGATCAAGGCGGGCGTGGACAACACCAAGGCGTCGCTGTGCGAGCTGGCCGACCAG
AGCATCGACGGCGACATCAAGGCGGCGGTGCGCAAGCAGACGCAGCGCGCGCTGGCCAACGTCGGCGAGGGCCAC
GAGGCCGAGCTGCGCGAGGTGAGCGGCATTAAGTCGGGCCAGAACTACCTGATCGACCTGGAGATGGCGGTGCCG
GGCGCCTGGACGGTCGAGTCGGTGCGCGAGCTCGAGGACGGCGTGCGGGCGCAGGTCGGCGGCAGGGTGCGCGGC
GTGCGGCGCGTGCGCGTGCGCTTCGTGCCGCGCGACGCGCCCGGCAGGGACCGCTTCGACGACTTCATCCCGGGC
TCCGTCCACGTCGAGGCGGACCCGGAGGAGCCCAAGGAGAGTCAGGTCGACGGCAGCGGCCACGGCAGCGGCAAC
GACCACGGCAGCGGCAACGGCAGCAGCTGCAACGGATCGGCACACAGGGGGCGGCAGCAGGACAGGCATAGACAC
TAA
Transcript >Hirsu2|2813
ATGAAGATTGCGCGCGAACGCAAGTCGTCGGTGCTGGCGTCCAACGCGATCCACCACCGCGTCGACAGCCTGACG
GGCATCGTGACGCTGGCGGCCATCCTGGGCGCCAACGTCTTCGACAACGCCGCCTGGCTGGACCCGGTGGGCGGG
CTGCTCATCTCGCTCATGGTGATCAAGGCGGGCGTGGACAACACCAAGGCGTCGCTGTGCGAGCTGGCCGACCAG
AGCATCGACGGCGACATCAAGGCGGCGGTGCGCAAGCAGACGCAGCGCGCGCTGGCCAACGTCGGCGAGGGCCAC
GAGGCCGAGCTGCGCGAGGTGAGCGGCATTAAGTCGGGCCAGAACTACCTGATCGACCTGGAGATGGCGGTGCCG
GGCGCCTGGACGGTCGAGTCGGTGCGCGAGCTCGAGGACGGCGTGCGGGCGCAGGTCGGCGGCAGGGTGCGCGGC
GTGCGGCGCGTGCGCGTGCGCTTCGTGCCGCGCGACGCGCCCGGCAGGGACCGCTTCGACGACTTCATCCCGGGC
TCCGTCCACGTCGAGGCGGACCCGGAGGAGCCCAAGGAGAGTCAGGTCGACGGCAGCGGCCACGGCAGCGGCAAC
GACCACGGCAGCGGCAACGGCAGCAGCTGCAACGGATCGGCACACAGGGGGCGGCAGCAGGACAGGCATAGACAC
TAA
Gene >Hirsu2|2813
ATGAAGATTGCGCGCGAACGCAAGTCGTCGGTGCTGGCGTCCAACGCGATCCACCACCGCGTCGACAGCCTGACG
GGCATCGTGACGCTGGCGGCCATCCTGGGCGCCAACGTCTTCGACAACGCCGCCTGGCTGGACCCGGTGGGCGGG
CTGCTCATCTCGCTCATGGTGATCAAGGCGGGCGTGGACAACACCAAGGCGTCGCTGTGCGAGCTGGCCGACCAG
AGCATCGACGGCGACATCAAGGCGGCGGTGCGCAAGCAGACGCAGCGCGCGCTGGCCAACGTCGGCGAGGGCCAC
GAGGCCGAGCTGCGCGAGGTGAGCGGCATTAAGTCGGGCCAGAACTACCTGATCGACCTGGAGATGGCGGTGCCG
GGCGCCTGGACGGTCGAGTCGGTGCGCGAGCTCGAGGACGGCGTGCGGGCGCAGGTCGGCGGCAGGGTGCGCGGC
GTGCGGCGCGTGCGCGTGCGCTTCGTGCCGCGCGACGCGCCCGGCAGGGACCGCTTCGACGACTTCATCCCGGGC
TCCGTCCACGTCGAGGCGGACCCGGAGGAGCCCAAGGAGAGTCAGGTCGACGGCAGCGGCCACGGCAGCGGCAAC
GACCACGGCAGCGGCAACGGCAGCAGCTGCAACGGATCGGCACACAGGGGGCGGCAGCAGGACAGGCATAGACAC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail