Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2798
Gene name
LocationContig_1691:519..3048
Strand-
Gene length (bp)2529
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 2.4E-49 282 588
PF00026 Asp Eukaryotic aspartyl protease 3.2E-31 72 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Q9|ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg9 PE=3 SV=1 281 720 3.0E-75
sp|Q8VDI9|ALG9_MOUSE Alpha-1,2-mannosyltransferase ALG9 OS=Mus musculus GN=Alg9 PE=2 SV=1 281 701 1.0E-69
sp|Q9H6U8|ALG9_HUMAN Alpha-1,2-mannosyltransferase ALG9 OS=Homo sapiens GN=ALG9 PE=1 SV=2 281 701 5.0E-68
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 9 298 2.0E-50
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 10 269 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Q9|ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg9 PE=3 SV=1 281 720 3.0E-75
sp|Q8VDI9|ALG9_MOUSE Alpha-1,2-mannosyltransferase ALG9 OS=Mus musculus GN=Alg9 PE=2 SV=1 281 701 1.0E-69
sp|Q9H6U8|ALG9_HUMAN Alpha-1,2-mannosyltransferase ALG9 OS=Homo sapiens GN=ALG9 PE=1 SV=2 281 701 5.0E-68
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 9 298 2.0E-50
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 10 269 1.0E-47
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 11 269 3.0E-47
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 29 268 3.0E-47
sp|P54002|YTH3_CAEEL Putative glycosyltransferase C14A4.3 OS=Caenorhabditis elegans GN=C14A4.3 PE=1 SV=2 282 701 4.0E-46
sp|P53868|ALG9_YEAST Alpha-1,2-mannosyltransferase ALG9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG9 PE=1 SV=1 282 721 3.0E-45
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 10 269 3.0E-41
sp|Q9FZ49|ALG9_ARATH Dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana GN=ALG9 PE=1 SV=1 282 719 8.0E-41
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 60 250 1.0E-30
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 60 250 4.0E-30
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 47 250 3.0E-28
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 47 250 3.0E-28
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 52 267 2.0E-27
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 60 250 7.0E-27
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 51 292 1.0E-26
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 59 271 1.0E-26
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 59 271 1.0E-26
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 59 271 1.0E-26
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 59 273 2.0E-26
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 59 273 2.0E-26
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 63 273 4.0E-26
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 51 271 1.0E-24
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 53 344 1.0E-24
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 51 271 2.0E-24
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 59 271 2.0E-24
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 59 271 2.0E-24
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 59 271 2.0E-24
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 35 279 4.0E-24
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 63 277 1.0E-23
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 72 291 8.0E-23
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 52 269 2.0E-21
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 68 250 5.0E-21
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 113 300 1.0E-18
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 65 273 3.0E-18
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 65 273 2.0E-17
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 56 250 2.0E-17
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 111 250 4.0E-16
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 111 250 8.0E-15
sp|Q92389|AXP1_YARLI Acid extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AXP1 PE=3 SV=1 60 266 3.0E-12
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 51 250 7.0E-10
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 64 252 8.0E-10
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 64 250 6.0E-09
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 64 250 6.0E-09
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 72 308 1.0E-08
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 9 250 1.0E-08
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 56 308 2.0E-08
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 63 251 3.0E-08
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 56 292 4.0E-08
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 64 250 6.0E-08
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 64 250 6.0E-08
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 52 250 7.0E-08
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 72 292 9.0E-08
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 45 250 1.0E-07
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 64 250 1.0E-07
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 29 250 1.0E-07
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 62 292 2.0E-07
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 64 250 2.0E-07
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 37 296 3.0E-07
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 64 250 5.0E-07
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 342 495 6.0E-07
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 64 250 9.0E-07
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 72 250 9.0E-07
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 28 251 1.0E-06
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 63 250 2.0E-06
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 63 182 2.0E-06
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 58 250 3.0E-06
sp|Q9VZM5|PIGB_DROME GPI mannosyltransferase 3 OS=Drosophila melanogaster GN=CG12006 PE=2 SV=2 300 486 3.0E-06
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 45 151 4.0E-06
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 64 250 5.0E-06
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 76 284 7.0E-06
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 64 250 7.0E-06
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 76 250 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 281 303 22
2 316 338 22
3 360 382 22
4 418 440 22
5 450 469 19
6 481 503 22
7 518 540 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2798
MKLPLPLPLLALAAAVLLPGTASGPRADRAPPRVVGASVQRRYVSGGRAAARLRGRADEPIDVPLSNQKVLYSIE
IEVGNPPQRMEVQLDTGSSDALLNTDRSALCTGRDNACAATGTYNANASSTSRYVNSRFNISYVDSSGAAGDFVT
DDVRLLGRLVPGVQLGVAYNSSTPQSVLGIGLTSNEAGDAGARRGGDEYANLPARMADDGVIASNAYSLWLNDLG
AANGSILFGGVDAARFRAPLVRLPLQPVAGRFTEFYVTLTGLAVAGNDTADGLAQAASAAFLPSSFAMGAVMLGA
AAFMDWRGGLKTSRAVFCFAAAAVLGWPFAAALCAPFLLEELVLAAFSDKEARIQSALRLGRGVVAGLLLLLFDF
LINLFFYKRAVVVTWNIVRYNIFSSTGGPGLYGTEPWHFYFRNLALNFNLWFVLALLALPLFLVQKLSGRGSQPG
LPLRTLVFVAPFYMWLAIFTAQPHKEERFMYPVYPFLVLNGSISLHMLLSAIGSSDPNALVARVPARLRLLAVGL
VLFLSLDVGLARIYGVYTAYRAPMAIYKPLWGGDEGGGAVGGPEDLVCFGKEWYRFPSSYFLPRDMHAKFVRSEF
RGLLPGEFSEARTGFGFWSGTWLPTSGLNDGNREDPGKYVDLRACSLLVDTQYPDRTEPLPPAEPDYVADSETWE
VVKCEPFLDAASTHVLARTLWLPDLALVPVRLRRRWGRHCLLKRRTTAN*
Coding >Hirsu2|2798
ATGAAGCTGCCGCTGCCGCTGCCGCTGCTGGCCCTCGCCGCCGCCGTGCTGCTGCCCGGCACGGCGTCGGGACCG
CGCGCCGACAGGGCACCGCCGCGCGTGGTGGGCGCCAGCGTCCAGCGGCGGTACGTGAGCGGCGGGCGGGCGGCG
GCGAGGCTGCGCGGCCGGGCCGATGAGCCCATCGACGTGCCGCTCAGCAACCAGAAAGTGCTATACTCGATCGAG
ATCGAGGTCGGCAACCCGCCGCAGCGGATGGAGGTGCAGCTGGACACGGGCAGCAGCGACGCGCTGCTCAACACG
GACCGGTCGGCGCTGTGCACGGGGCGCGACAACGCGTGCGCGGCGACGGGCACGTACAACGCCAACGCGTCGTCG
ACGTCGCGCTACGTCAACAGCCGCTTCAACATATCGTACGTCGACAGCTCGGGCGCGGCGGGCGACTTCGTGACG
GACGACGTGCGGCTGCTGGGCCGGCTCGTGCCGGGCGTGCAGCTGGGCGTGGCCTACAACAGCAGCACGCCGCAG
TCGGTGCTGGGCATCGGGCTGACGAGCAACGAGGCGGGCGACGCGGGCGCGCGCCGCGGCGGCGACGAGTACGCC
AACCTGCCGGCGCGCATGGCCGACGACGGCGTCATCGCCAGCAACGCCTACAGCCTGTGGCTCAACGACCTGGGC
GCCGCCAACGGCAGCATCCTGTTCGGCGGCGTCGACGCCGCCCGCTTCCGCGCCCCGCTCGTCCGCCTGCCGCTG
CAGCCCGTCGCCGGCCGCTTCACCGAGTTCTACGTGACGCTGACGGGGCTGGCCGTCGCCGGCAACGACACGGCC
GACGGCCTGGCCCAGGCCGCCAGCGCCGCCTTTCTGCCGTCCAGCTTCGCCATGGGCGCCGTCATGCTCGGCGCC
GCCGCCTTCATGGACTGGCGTGGCGGCCTCAAGACGTCGCGCGCCGTCTTCTGCTTCGCTGCCGCGGCCGTCCTC
GGCTGGCCCTTTGCCGCCGCCCTGTGCGCGCCCTTTTTGCTCGAGGAGCTCGTCCTCGCCGCCTTTAGCGATAAG
GAGGCCCGCATCCAGTCGGCCCTCCGCCTCGGCCGCGGCGTCGTCGCCGGCCTCCTCCTCCTCCTCTTCGACTTC
TTGATCAACCTCTTCTTCTACAAGAGGGCCGTCGTCGTCACGTGGAACATCGTCCGGTACAACATCTTCTCCTCC
ACCGGCGGCCCCGGCCTCTACGGCACCGAGCCCTGGCACTTCTACTTCAGGAACCTGGCCCTCAACTTCAATCTC
TGGTTCGTCCTCGCCCTCCTGGCCCTGCCGCTCTTCCTCGTCCAGAAGCTGTCCGGCCGGGGCTCGCAGCCCGGA
CTGCCGCTGCGCACCCTCGTCTTCGTCGCGCCCTTCTACATGTGGCTGGCCATCTTCACGGCCCAGCCGCACAAG
GAAGAGCGCTTCATGTATCCCGTCTACCCCTTCCTGGTCCTCAACGGCTCCATCTCGCTGCACATGCTGCTGTCG
GCCATTGGCAGCTCGGACCCCAACGCCTTGGTGGCCCGGGTCCCCGCTCGCCTGCGCCTCCTCGCCGTCGGCCTC
GTCCTCTTCCTGTCCCTCGACGTCGGCCTGGCGCGCATCTACGGCGTCTACACGGCCTACCGGGCCCCGATGGCC
ATCTACAAGCCCCTGTGGGGCGGAGATGAGGGAGGCGGCGCCGTGGGCGGGCCCGAGGACCTCGTCTGTTTCGGC
AAGGAGTGGTATCGCTTCCCCTCGTCCTACTTCCTCCCGCGCGACATGCACGCCAAGTTCGTCCGCTCCGAGTTC
CGCGGCCTGCTGCCGGGCGAGTTCTCCGAGGCCAGGACCGGCTTCGGCTTCTGGAGCGGCACCTGGCTGCCCACG
AGCGGGCTCAACGACGGCAACCGCGAGGACCCGGGCAAGTACGTCGACCTCCGCGCGTGCTCGCTCCTCGTCGAC
ACGCAGTACCCCGACCGGACAGAGCCGCTGCCGCCCGCCGAGCCCGACTACGTCGCCGACTCCGAGACGTGGGAG
GTGGTCAAGTGCGAGCCCTTCCTCGACGCCGCCAGCACACACGTCCTCGCACGGACGCTCTGGCTCCCGGATCTG
GCCTTGGTCCCGGTCCGGCTCAGGAGGAGGTGGGGCCGCCACTGTCTGCTGAAACGAAGGACCACGGCGAACTGA
Transcript >Hirsu2|2798
ATGAAGCTGCCGCTGCCGCTGCCGCTGCTGGCCCTCGCCGCCGCCGTGCTGCTGCCCGGCACGGCGTCGGGACCG
CGCGCCGACAGGGCACCGCCGCGCGTGGTGGGCGCCAGCGTCCAGCGGCGGTACGTGAGCGGCGGGCGGGCGGCG
GCGAGGCTGCGCGGCCGGGCCGATGAGCCCATCGACGTGCCGCTCAGCAACCAGAAAGTGCTATACTCGATCGAG
ATCGAGGTCGGCAACCCGCCGCAGCGGATGGAGGTGCAGCTGGACACGGGCAGCAGCGACGCGCTGCTCAACACG
GACCGGTCGGCGCTGTGCACGGGGCGCGACAACGCGTGCGCGGCGACGGGCACGTACAACGCCAACGCGTCGTCG
ACGTCGCGCTACGTCAACAGCCGCTTCAACATATCGTACGTCGACAGCTCGGGCGCGGCGGGCGACTTCGTGACG
GACGACGTGCGGCTGCTGGGCCGGCTCGTGCCGGGCGTGCAGCTGGGCGTGGCCTACAACAGCAGCACGCCGCAG
TCGGTGCTGGGCATCGGGCTGACGAGCAACGAGGCGGGCGACGCGGGCGCGCGCCGCGGCGGCGACGAGTACGCC
AACCTGCCGGCGCGCATGGCCGACGACGGCGTCATCGCCAGCAACGCCTACAGCCTGTGGCTCAACGACCTGGGC
GCCGCCAACGGCAGCATCCTGTTCGGCGGCGTCGACGCCGCCCGCTTCCGCGCCCCGCTCGTCCGCCTGCCGCTG
CAGCCCGTCGCCGGCCGCTTCACCGAGTTCTACGTGACGCTGACGGGGCTGGCCGTCGCCGGCAACGACACGGCC
GACGGCCTGGCCCAGGCCGCCAGCGCCGCCTTTCTGCCGTCCAGCTTCGCCATGGGCGCCGTCATGCTCGGCGCC
GCCGCCTTCATGGACTGGCGTGGCGGCCTCAAGACGTCGCGCGCCGTCTTCTGCTTCGCTGCCGCGGCCGTCCTC
GGCTGGCCCTTTGCCGCCGCCCTGTGCGCGCCCTTTTTGCTCGAGGAGCTCGTCCTCGCCGCCTTTAGCGATAAG
GAGGCCCGCATCCAGTCGGCCCTCCGCCTCGGCCGCGGCGTCGTCGCCGGCCTCCTCCTCCTCCTCTTCGACTTC
TTGATCAACCTCTTCTTCTACAAGAGGGCCGTCGTCGTCACGTGGAACATCGTCCGGTACAACATCTTCTCCTCC
ACCGGCGGCCCCGGCCTCTACGGCACCGAGCCCTGGCACTTCTACTTCAGGAACCTGGCCCTCAACTTCAATCTC
TGGTTCGTCCTCGCCCTCCTGGCCCTGCCGCTCTTCCTCGTCCAGAAGCTGTCCGGCCGGGGCTCGCAGCCCGGA
CTGCCGCTGCGCACCCTCGTCTTCGTCGCGCCCTTCTACATGTGGCTGGCCATCTTCACGGCCCAGCCGCACAAG
GAAGAGCGCTTCATGTATCCCGTCTACCCCTTCCTGGTCCTCAACGGCTCCATCTCGCTGCACATGCTGCTGTCG
GCCATTGGCAGCTCGGACCCCAACGCCTTGGTGGCCCGGGTCCCCGCTCGCCTGCGCCTCCTCGCCGTCGGCCTC
GTCCTCTTCCTGTCCCTCGACGTCGGCCTGGCGCGCATCTACGGCGTCTACACGGCCTACCGGGCCCCGATGGCC
ATCTACAAGCCCCTGTGGGGCGGAGATGAGGGAGGCGGCGCCGTGGGCGGGCCCGAGGACCTCGTCTGTTTCGGC
AAGGAGTGGTATCGCTTCCCCTCGTCCTACTTCCTCCCGCGCGACATGCACGCCAAGTTCGTCCGCTCCGAGTTC
CGCGGCCTGCTGCCGGGCGAGTTCTCCGAGGCCAGGACCGGCTTCGGCTTCTGGAGCGGCACCTGGCTGCCCACG
AGCGGGCTCAACGACGGCAACCGCGAGGACCCGGGCAAGTACGTCGACCTCCGCGCGTGCTCGCTCCTCGTCGAC
ACGCAGTACCCCGACCGGACAGAGCCGCTGCCGCCCGCCGAGCCCGACTACGTCGCCGACTCCGAGACGTGGGAG
GTGGTCAAGTGCGAGCCCTTCCTCGACGCCGCCAGCACACACGTCCTCGCACGGACGCTCTGGCTCCCGGATCTG
GCCTTGGTCCCGGTCCGGCTCAGGAGGAGGTGGGGCCGCCACTGTCTGCTGAAACGAAGGACCACGGCGAACTGA
Gene >Hirsu2|2798
ATGAAGCTGCCGCTGCCGCTGCCGCTGCTGGCCCTCGCCGCCGCCGTGCTGCTGCCCGGCACGGCGTCGGGACCG
CGCGCCGACAGGGCACCGCCGCGCGTGGTGGGCGCCAGCGTCCAGCGGCGGTACGTGAGCGGCGGGCGGGCGGCG
GCGAGGCTGCGCGGCCGGGCCGATGAGCCCATCGACGTGCCGCTCAGCAACCAGGTGCGTTTGATTTTCCCGTCT
CCTCCTCTCGCCCCCGTCCCGATCCTCGACTCGAACCAGGAGCACAAGGCAAAGAAGAAGAAGAAGAAGAAGAAG
AAAAAGAAGGAAAGGGGTGGGCTGACGAGCGAGTTGGATGCAGAAAGTGCTATACTCGATCGAGATCGAGGTCGG
CAACCCGCCGCAGCGGATGGAGGTGCAGCTGGACACGGGCAGCAGCGACGCGCTGCTCAACACGGACCGGTCGGC
GCTGTGCACGGGGCGCGACAACGCGTGCGCGGCGACGGGCACGTACAACGCCAACGCGTCGTCGACGTCGCGCTA
CGTCAACAGCCGCTTCAACATATCGTACGTCGACAGCTCGGGCGCGGCGGGCGACTTCGTGACGGACGACGTGCG
GCTGCTGGGCCGGCTCGTGCCGGGCGTGCAGCTGGGCGTGGCCTACAACAGCAGCACGCCGCAGTCGGTGCTGGG
CATCGGGCTGACGAGCAACGAGGCGGGCGACGCGGGCGCGCGCCGCGGCGGCGACGAGTACGCCAACCTGCCGGC
GCGCATGGCCGACGACGGCGTCATCGCCAGCAACGCCTACAGCCTGTGGCTCAACGACCTGGGCGCCGCCAACGG
CAGCATCCTGTTCGGCGGCGTCGACGCCGCCCGCTTCCGCGCCCCGCTCGTCCGCCTGCCGCTGCAGCCCGTCGC
CGGCCGCTTCACCGAGTTCTACGTGACGCTGACGGGGCTGGCCGTCGCCGGCAACGACACGGCCGACGGCCTGGC
CCAGGCCGTCCTGCTCGACTCGGGCTCCACCTTCAGCTACCTGCCGGAGCGGCTGGCGGCGCGCCGTCTGCGCCG
CGCTCGGCGGCCGCGTCGGCCTCGTCTTCCTCGTCGCCACCGTCGCCAGCCCCGGCAACTTCCAGGCCAGCGCCG
CCTTTCTGCCGTCCAGCTTCGCCATGGGCGCCGTCATGCTCGGCGCCGCCGCCTTCATGGACTGGCGTGGCGGCC
TCAAGACGTCGCGCGCCGTCTTCTGCTTCGCTGCCGCGGCCGTCCTCGGCTGGCCCTTTGCCGCCGCCCTGTGCG
CGCCCTTTTTGCTCGAGGAGCTCGTCCTCGCCGCCTTTAGCGATAAGGAGGCCCGCATCCAGTCGGCCCTCCGCC
TCGGCCGCGGCGTCGTCGCCGGCCTCCTCCTCCTCGTGAGTGGCTGCCCTTGGCACCAAGCTTGGACGGGCGGCC
TTTGCTCACCAGACTCACTCGTCCCCCCCCCCCCACCCCCAGCTCTTCGACTTCTTGATCAACCTCTTCTTCTAC
AAGAGGGCCGTCGTCGTCACGTGGAACATCGTCCGGTACAACATCTTCTCCTCCACCGGCGGCCCCGGCCTCTAC
GGCACCGAGCCCTGGCACTTCTACTTCAGGAACCTGGCCCTCAACTTCAATCTCTGGTTCGTCCTCGCCCTCCTG
GCCCTGCCGCTCTTCCTCGTCCAGAAGCTGTCCGGCCGGGGCTCGCAGCCCGGACTGCCGCTGCGCACCCTCGTC
TTCGTCGCGCCCTTCTACATGTGGCTGGCCATCTTCACGGCCCAGCCGCACAAGGAAGAGCGCTTCATGTATCCC
GTCTACCCCTTCCTGGTCCTCAACGGCTCCATCTCGCTGCACATGCTGCTGTCGGCCATTGGCAGCTCGGACCCC
AACGCCTTGGTGGCCCGGGTCCCCGCTCGCCTGCGCCTCCTCGCCGTCGGCCTCGTCCTCTTCCTGTCCCTCGAC
GTCGGCCTGGCGCGCATCTACGGCGTCTACACGGCCTACCGGGCCCCGATGGCCATCTACAAGCCCCTGTGGGGC
GGAGATGAGGGAGGCGGCGCCGTGGGCGGGCCCGAGGACCTCGTCTGTTTCGGCAAGGAGTGGTATCGCTTCCCC
TCGTCCTACTTCCTCCCGCGCGACATGCACGCCAAGTTCGTCCGCTCCGAGTTCCGCGGCCTGCTGCCGGGCGAG
TTCTCCGAGGCCAGGACCGGCTTCGGCTTCTGGAGCGGCACCTGGCTGCCCACGAGCGGGCTCAACGACGGCAAC
CGCGAGGACCCGGGCAAGTACGTCGACCTCCGCGCGTGCTCGCTCCTCGTCGACACGCAGTACCCCGACCGGACA
GAGCCGCTGCCGCCCGCCGAGCCCGACTACGTCGCCGACTCCGAGACGTGGGAGGTGGTCAAGTGCGAGCCCTTC
CTCGACGCCGCCAGCACACACGTCCTCGCACGGACGCTCTGGCTCCCGGATCTGGCCTTGGTCCCGGTCCGGCTC
AGGAGGAGGTGGGGCCGCCACTGTCTGCTGAAACGAAGGACCACGGCGAACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail