Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2795
Gene name
LocationContig_1690:11..2152
Strand+
Gene length (bp)2141
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 1.3E-07 294 507

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 219 668 6.0E-14
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 219 584 1.0E-13
sp|O62852|TRPC5_RABIT Short transient receptor potential channel 5 OS=Oryctolagus cuniculus GN=TRPC5 PE=2 SV=1 204 542 1.0E-09
sp|Q9QX29|TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus GN=Trpc5 PE=1 SV=2 204 542 1.0E-09
sp|Q9UL62|TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens GN=TRPC5 PE=1 SV=1 204 542 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 219 668 6.0E-14
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 219 584 1.0E-13
sp|O62852|TRPC5_RABIT Short transient receptor potential channel 5 OS=Oryctolagus cuniculus GN=TRPC5 PE=2 SV=1 204 542 1.0E-09
sp|Q9QX29|TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus GN=Trpc5 PE=1 SV=2 204 542 1.0E-09
sp|Q9UL62|TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens GN=TRPC5 PE=1 SV=1 204 542 2.0E-09
sp|Q8R455|TRPM8_RAT Transient receptor potential cation channel subfamily M member 8 OS=Rattus norvegicus GN=Trpm8 PE=1 SV=4 215 415 2.0E-07
sp|Q8R4D5|TRPM8_MOUSE Transient receptor potential cation channel subfamily M member 8 OS=Mus musculus GN=Trpm8 PE=1 SV=3 215 415 2.0E-07
sp|Q7Z2W7|TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens GN=TRPM8 PE=1 SV=2 215 415 3.0E-07
sp|Q9QUQ5|TRPC4_MOUSE Short transient receptor potential channel 4 OS=Mus musculus GN=Trpc4 PE=1 SV=1 313 542 4.0E-07
sp|P79100|TRPC4_BOVIN Short transient receptor potential channel 4 OS=Bos taurus GN=TRPC4 PE=2 SV=2 313 542 4.0E-07
sp|O35119|TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus GN=Trpc4 PE=1 SV=2 313 542 5.0E-07
sp|Q9UBN4|TRPC4_HUMAN Short transient receptor potential channel 4 OS=Homo sapiens GN=TRPC4 PE=1 SV=1 313 542 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005216 ion channel activity Yes
GO:0006811 ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0015267 channel activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0022838 substrate-specific channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 288 305 17
2 346 368 22
3 390 412 22
4 419 441 22
5 446 468 22
6 475 497 22
7 532 554 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2795
MPIRLRTRLPAPRDVSPVSARLEFDLPDIDDDDSFRQVAAKLSGYFVDAVDLPSTFEQLRTTAAGNCIRVLVDHL
YASCSNPATVHALLALKWHYAAESEHVGLSETRSNACEIVAWRFLARLSGREAMDFCLYEIPAEHHIDHDPGQHR
PRQLPCEHDGEAAETSPLIRRIRLGPQLDVPPVGRPSKRTKLESSLPGLTRDADDPVDDLDPTAAFKGLNALEIA
AVADAKRFLSQHLVQKIISGIWNGDIVFWDALSVRASKKPRFYDAETADPFSRLRVPKYLKSWEVVFFAVFLCLY
YAVLVARVESHVTATEVALFVWIAAFAYDELSEWIDAGSIFYTTDIWNLFDLTMILISFIFAALRIIGLARQDSY
LTGLAFDILSLEALFMMPRLCSVLSLSPYWGTLIPCLKEMGKDFLKFMVLVVIVYLGFLTTFSLVGRDSFSLYTM
TGILTKIFFGNSYVGFEIMNQIDTVFGPPLMIIFITLTSILLTGSLTGMLSNSFSRVITHAREEYLYVYSVYVLE
ASTSNRLTHFYPPFNLIALIIFRPLRLVFSRDEKFRAGRIVLLKITHLPVVAAIKLYELIRQKVGSERQASLRGQ
PKAKRGAARTQVLFGRPSSGHSRQQLQPLRGLQTTRDEDDVEVPSPVEVQLAEMNRKIDKLTSVVMALQAGQTGA
PLGEKAT*
Coding >Hirsu2|2795
ATGCCCATCCGCCTCCGGACGCGGCTCCCGGCGCCGCGCGACGTGAGCCCCGTCTCGGCCCGGCTCGAGTTCGAC
CTGCCCGACATCGACGACGACGACTCGTTCCGCCAAGTGGCCGCCAAGCTGTCCGGCTACTTTGTCGATGCCGTC
GATCTGCCCAGCACCTTCGAGCAGCTGCGGACGACGGCCGCCGGCAACTGCATCCGCGTTCTGGTCGACCATCTG
TACGCCTCGTGCTCCAACCCGGCTACGGTCCACGCCCTGCTCGCCCTCAAGTGGCACTACGCCGCCGAGAGCGAG
CACGTCGGACTGAGCGAGACGCGCTCCAACGCCTGCGAGATCGTTGCCTGGCGCTTCCTCGCCCGCCTGTCGGGG
CGCGAGGCCATGGACTTTTGCCTCTACGAGATCCCAGCCGAGCATCACATTGACCACGACCCGGGCCAGCATCGC
CCTCGGCAGCTGCCGTGCGAGCACGACGGAGAGGCTGCCGAGACGTCACCGCTGATCCGCCGCATCCGTCTCGGC
CCCCAGCTCGACGTCCCGCCCGTCGGCCGCCCCTCCAAGCGCACCAAGCTGGAGAGCTCCCTGCCCGGCCTGACG
CGTGACGCCGACGACCCCGTCGACGACCTGGATCCCACGGCCGCCTTCAAGGGCCTCAACGCACTCGAGATTGCC
GCCGTCGCCGACGCCAAGCGCTTCCTCAGCCAGCACCTCGTCCAGAAAATCATCAGCGGCATCTGGAACGGCGAC
ATTGTCTTCTGGGACGCCCTGTCCGTCCGCGCCAGCAAGAAGCCCCGCTTCTACGACGCCGAGACTGCGGACCCC
TTCTCGCGCCTGCGCGTCCCCAAGTACCTCAAGAGCTGGGAGGTCGTCTTCTTCGCCGTCTTCCTCTGCCTCTAC
TACGCCGTCCTGGTCGCCCGCGTCGAGAGCCACGTCACCGCCACCGAGGTCGCCCTCTTCGTCTGGATCGCCGCC
TTCGCCTACGACGAGCTGAGCGAGTGGATCGACGCCGGCTCCATCTTCTACACCACCGACATCTGGAATCTTTTT
GACCTGACCATGATCCTCATCAGCTTTATCTTCGCTGCCCTGAGAATCATCGGCCTCGCTCGGCAGGACAGCTAC
CTCACCGGCCTCGCCTTCGACATCCTATCGCTCGAGGCCCTTTTCATGATGCCGCGCCTGTGCTCCGTCCTCAGC
CTGAGCCCCTACTGGGGCACCCTGATACCCTGTCTTAAGGAGATGGGCAAGGACTTCCTCAAGTTCATGGTGCTC
GTCGTCATCGTCTACCTCGGCTTCCTCACCACCTTCTCCCTCGTCGGTCGTGACTCCTTCAGCCTGTACACCATG
ACCGGCATCTTGACCAAAATCTTCTTCGGCAACAGCTACGTCGGCTTCGAAATCATGAACCAGATCGACACCGTC
TTTGGGCCCCCGCTCATGATCATCTTCATCACCCTGACGTCCATCCTGCTGACCGGGTCCCTGACGGGCATGTTG
TCCAACAGCTTCTCTCGCGTCATCACGCATGCCCGAGAGGAGTATCTATACGTCTACAGCGTCTACGTGTTGGAG
GCGTCGACCAGCAACAGGCTCACCCACTTCTATCCGCCCTTCAACCTCATCGCCCTCATTATTTTTCGACCCTTG
CGACTCGTCTTCTCTAGGGATGAAAAGTTTCGTGCCGGCCGCATTGTCCTGCTCAAAATCACCCACCTCCCCGTC
GTGGCGGCCATCAAGCTCTACGAGCTCATCCGACAAAAGGTCGGCAGTGAGCGCCAGGCCAGCCTTCGAGGTCAA
CCGAAGGCCAAACGGGGGGCGGCAAGGACGCAGGTGCTGTTCGGCAGACCGTCTTCCGGCCATAGTCGACAGCAG
CTGCAGCCTCTGCGGGGCTTGCAGACGACGAGAGACGAGGACGACGTGGAAGTCCCTTCTCCCGTCGAGGTCCAG
CTGGCGGAGATGAATCGCAAGATCGATAAACTCACCTCGGTGGTCATGGCTTTGCAGGCGGGCCAGACTGGGGCC
CCTCTAGGTGAGAAAGCTACGTAA
Transcript >Hirsu2|2795
ATGCCCATCCGCCTCCGGACGCGGCTCCCGGCGCCGCGCGACGTGAGCCCCGTCTCGGCCCGGCTCGAGTTCGAC
CTGCCCGACATCGACGACGACGACTCGTTCCGCCAAGTGGCCGCCAAGCTGTCCGGCTACTTTGTCGATGCCGTC
GATCTGCCCAGCACCTTCGAGCAGCTGCGGACGACGGCCGCCGGCAACTGCATCCGCGTTCTGGTCGACCATCTG
TACGCCTCGTGCTCCAACCCGGCTACGGTCCACGCCCTGCTCGCCCTCAAGTGGCACTACGCCGCCGAGAGCGAG
CACGTCGGACTGAGCGAGACGCGCTCCAACGCCTGCGAGATCGTTGCCTGGCGCTTCCTCGCCCGCCTGTCGGGG
CGCGAGGCCATGGACTTTTGCCTCTACGAGATCCCAGCCGAGCATCACATTGACCACGACCCGGGCCAGCATCGC
CCTCGGCAGCTGCCGTGCGAGCACGACGGAGAGGCTGCCGAGACGTCACCGCTGATCCGCCGCATCCGTCTCGGC
CCCCAGCTCGACGTCCCGCCCGTCGGCCGCCCCTCCAAGCGCACCAAGCTGGAGAGCTCCCTGCCCGGCCTGACG
CGTGACGCCGACGACCCCGTCGACGACCTGGATCCCACGGCCGCCTTCAAGGGCCTCAACGCACTCGAGATTGCC
GCCGTCGCCGACGCCAAGCGCTTCCTCAGCCAGCACCTCGTCCAGAAAATCATCAGCGGCATCTGGAACGGCGAC
ATTGTCTTCTGGGACGCCCTGTCCGTCCGCGCCAGCAAGAAGCCCCGCTTCTACGACGCCGAGACTGCGGACCCC
TTCTCGCGCCTGCGCGTCCCCAAGTACCTCAAGAGCTGGGAGGTCGTCTTCTTCGCCGTCTTCCTCTGCCTCTAC
TACGCCGTCCTGGTCGCCCGCGTCGAGAGCCACGTCACCGCCACCGAGGTCGCCCTCTTCGTCTGGATCGCCGCC
TTCGCCTACGACGAGCTGAGCGAGTGGATCGACGCCGGCTCCATCTTCTACACCACCGACATCTGGAATCTTTTT
GACCTGACCATGATCCTCATCAGCTTTATCTTCGCTGCCCTGAGAATCATCGGCCTCGCTCGGCAGGACAGCTAC
CTCACCGGCCTCGCCTTCGACATCCTATCGCTCGAGGCCCTTTTCATGATGCCGCGCCTGTGCTCCGTCCTCAGC
CTGAGCCCCTACTGGGGCACCCTGATACCCTGTCTTAAGGAGATGGGCAAGGACTTCCTCAAGTTCATGGTGCTC
GTCGTCATCGTCTACCTCGGCTTCCTCACCACCTTCTCCCTCGTCGGTCGTGACTCCTTCAGCCTGTACACCATG
ACCGGCATCTTGACCAAAATCTTCTTCGGCAACAGCTACGTCGGCTTCGAAATCATGAACCAGATCGACACCGTC
TTTGGGCCCCCGCTCATGATCATCTTCATCACCCTGACGTCCATCCTGCTGACCGGGTCCCTGACGGGCATGTTG
TCCAACAGCTTCTCTCGCGTCATCACGCATGCCCGAGAGGAGTATCTATACGTCTACAGCGTCTACGTGTTGGAG
GCGTCGACCAGCAACAGGCTCACCCACTTCTATCCGCCCTTCAACCTCATCGCCCTCATTATTTTTCGACCCTTG
CGACTCGTCTTCTCTAGGGATGAAAAGTTTCGTGCCGGCCGCATTGTCCTGCTCAAAATCACCCACCTCCCCGTC
GTGGCGGCCATCAAGCTCTACGAGCTCATCCGACAAAAGGTCGGCAGTGAGCGCCAGGCCAGCCTTCGAGGTCAA
CCGAAGGCCAAACGGGGGGCGGCAAGGACGCAGGTGCTGTTCGGCAGACCGTCTTCCGGCCATAGTCGACAGCAG
CTGCAGCCTCTGCGGGGCTTGCAGACGACGAGAGACGAGGACGACGTGGAAGTCCCTTCTCCCGTCGAGGTCCAG
CTGGCGGAGATGAATCGCAAGATCGATAAACTCACCTCGGTGGTCATGGCTTTGCAGGCGGGCCAGACTGGGGCC
CCTCTAGGTGAGAAAGCTACGTAA
Gene >Hirsu2|2795
ATGCCCATCCGCCTCCGGACGCGGCTCCCGGCGCCGCGCGACGTGAGCCCCGTCTCGGCCCGGCTCGAGTTCGAC
CTGCCCGACATCGACGACGACGACTCGTTCCGCCAAGTGGCCGCCAAGCTGTCCGGCTACTTTGTCGATGCCGTC
GATCTGCCCAGCACCTTCGAGCAGCTGCGGACGACGGCCGCCGGCAACTGCATCCGCGTTCTGGTCGACCATCTG
TACGCCTCGTGCTCCAACCCGGCTACGGTCCACGCCCTGCTCGCCCTCAAGTGGCACTACGCCGCCGAGAGCGAG
CACGTCGGACTGAGCGAGACGCGCTCCAACGCCTGCGAGATCGTTGCCTGGCGCTTCCTCGCCCGCCTGTCGGGG
CGCGAGGCCATGGACTTTTGCCTCTACGAGATCCCAGCCGAGCATCACATTGACCACGACCCGGGCCAGCATCGC
CCTCGGCAGCTGCCGTGCGAGCACGACGGAGAGGCTGCCGAGACGTCACCGCTGATCCGCCGCATCCGTCTCGGC
CCCCAGCTCGACGTCCCGCCCGTCGGCCGCCCCTCCAAGCGCACCAAGCTGGAGAGCTCCCTGCCCGGCCTGACG
CGTGACGCCGACGACCCCGTCGACGACCTGGATCCCACGGCCGCCTTCAAGGGCCTCAACGCACTCGAGATTGCC
GCCGTCGCCGACGCCAAGCGCTTCCTCAGCCAGCACCTCGTCCAGAAAATCATCAGCGGCATCTGGAACGGCGAC
ATTGTCTTCTGGGACGCCCTGTCCGTCCGCGCCAGCAAGAAGCCCCGCTTCTACGACGCCGAGACTGCGGACCCC
TTCTCGCGCCTGCGCGTCCCCAAGTACCTCAAGAGCTGGGAGGTCGTCTTCTTCGCCGTCTTCCTCTGCCTCTAC
TACGCCGTCCTGGTCGCCCGCGTCGAGAGCCACGTCACCGCCACCGAGGTCGCCCTCTTCGTCTGGATCGCCGCC
TTCGCCTACGACGAGCTGAGCGAGTGGATCGACGCCGGCTCCATCTTCTACACCACCGACATCTGGAATCTTTTT
GACCTGACCATGATCCTCATCAGCTTTATCTTCGCTGCCCTGAGTGAGTAGGGCTGCGGCCTCTTCCCCCCATAG
TCCCCCACGGCCTGGCTCTCCAAGGCTTGTGCTGACCTTGCACGTGTCCTCAACTTCAAGGAATCATCGGCCTCG
CTCGGCAGGACAGCTACCTCACCGGCCTCGCCTTCGACATCCTATCGCTCGAGGCCCTTTTCATGATGCCGCGCC
TGTGCTCCGTCCTCAGCCTGAGCCCCTACTGGGGCACCCTGATACCCTGTCTTAAGGAGATGGGCAAGGACTTCC
TCAAGTTCATGGTGCTCGTCGTCATCGTCTACCTCGGCTTCCTCACCACCTTCTCCCTCGTCGGTCGTGACTCCT
TCAGCCTGTACACCATGACCGGCATCTTGACCAAAATCTTCTTCGGCAACAGCTACGTCGGCTTCGAAATCATGA
ACCAGATCGACACCGTCTTTGGGCCCCCGCTCATGATCATCTTCATCACCCTGACGTCCATCCTGCTGACCGGGT
CCCTGACGGGCATGTTGTCCAACAGCTTCTCTCGCGTCATCACGCATGCCCGAGAGGAGTATCTATACGTCTACA
GCGTCTACGTGTTGGAGGCGTCGACCAGCAACAGGCTCACCCACTTCTATCCGCCCTTCAACCTCATCGCCCTCA
TTATTTTTCGACCCTTGCGACTCGTCTTCTCTAGGGATGAAAAGTTTCGTGCCGGCCGCATTGTCCTGCTCAAAA
TCACCCACCTCCCCGTCGTGGCGGCCATCAAGCTCTACGAGCTCATCCGACAAAAGGTCGGCAGTGAGCGCCAGG
CCAGCCTTCGAGGTCAACCGAAGGCCAAACGGGGGGCGGCAAGGACGCAGGTGCTGTTCGGCAGACCGTCTTCCG
GCCATAGTCGACAGCAGCTGCAGCCTCTGCGGGGCTTGCAGACGACGAGAGACGAGGACGACGTGGAAGTCCCTT
CTCCCGTCGAGGTCCAGCTGGCGGAGATGAATCGCAAGATCGATAAACTCACCTCGGTGGTCATGGCTTTGCAGG
CGGGCCAGACTGGGGCCCCTCTAGGTGAGAAAGCTACGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail