Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2794
Gene name
LocationContig_169:29954..32168
Strand+
Gene length (bp)2214
Transcript length (bp)2013
Coding sequence length (bp)2013
Protein length (aa) 671

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13418 Kelch_4 Galactose oxidase, central domain 5.2E-09 148 197
PF13418 Kelch_4 Galactose oxidase, central domain 4.7E-05 199 241
PF13418 Kelch_4 Galactose oxidase, central domain 7.0E-05 247 282
PF13854 Kelch_5 Kelch motif 1.2E-04 97 130
PF13854 Kelch_5 Kelch motif 6.8E-07 197 237
PF01344 Kelch_1 Kelch motif 2.4E-04 153 189
PF01344 Kelch_1 Kelch motif 2.4E-05 200 241
PF13415 Kelch_3 Galactose oxidase, central domain 5.2E-06 105 155
PF13415 Kelch_3 Galactose oxidase, central domain 2.9E-05 158 207
PF00651 BTB BTB/POZ domain 7.2E-08 562 656

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 98 241 2.0E-18
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 148 287 6.0E-18
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 84 265 2.0E-15
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 103 267 4.0E-15
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 105 241 8.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 98 241 2.0E-18
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 148 287 6.0E-18
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 84 265 2.0E-15
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 103 267 4.0E-15
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 105 241 8.0E-15
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 103 277 3.0E-14
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 131 282 2.0E-13
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 131 282 2.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 84 240 3.0E-13
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 101 276 4.0E-13
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 108 284 5.0E-13
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 108 284 5.0E-13
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 131 282 6.0E-13
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 62 277 7.0E-13
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 108 284 7.0E-13
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 103 267 1.0E-12
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 97 231 1.0E-12
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 89 227 2.0E-12
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 86 281 2.0E-12
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 108 284 2.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 106 285 3.0E-12
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 106 285 3.0E-12
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 96 277 3.0E-12
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 107 267 5.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 106 285 5.0E-12
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 103 241 5.0E-12
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 89 269 1.0E-11
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 103 241 2.0E-11
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 78 269 5.0E-11
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 144 268 1.0E-10
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 107 265 1.0E-10
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 108 269 2.0E-10
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 106 285 2.0E-10
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 98 265 4.0E-10
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 121 282 4.0E-10
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 144 268 5.0E-10
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 144 268 5.0E-10
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 144 268 6.0E-10
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 89 268 8.0E-10
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 97 285 9.0E-10
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 97 285 9.0E-10
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 106 267 1.0E-09
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 106 285 2.0E-09
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 124 283 2.0E-09
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 89 295 2.0E-09
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 87 282 4.0E-09
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 87 282 4.0E-09
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 87 282 4.0E-09
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 87 282 4.0E-09
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 87 282 4.0E-09
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 148 282 1.0E-08
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 148 282 1.0E-08
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 99 265 1.0E-08
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 108 269 1.0E-08
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 123 282 2.0E-08
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 9 265 2.0E-08
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 105 217 2.0E-08
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 134 282 3.0E-08
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 134 282 3.0E-08
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 134 282 3.0E-08
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 68 253 3.0E-08
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 97 285 3.0E-08
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 106 319 3.0E-08
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 68 244 4.0E-08
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 68 244 4.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 105 217 4.0E-08
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 92 241 5.0E-08
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 87 282 5.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 59 241 6.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 59 241 6.0E-08
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 81 277 6.0E-08
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 186 269 8.0E-08
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 89 241 8.0E-08
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 89 241 8.0E-08
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 81 277 9.0E-08
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 89 241 1.0E-07
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 88 282 2.0E-07
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 134 282 2.0E-07
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 92 241 2.0E-07
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 81 277 2.0E-07
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 89 277 2.0E-07
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 108 241 3.0E-07
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 98 265 3.0E-07
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 81 277 3.0E-07
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 106 281 3.0E-07
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 148 282 4.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 150 265 4.0E-07
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 89 277 4.0E-07
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 103 260 5.0E-07
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 158 265 6.0E-07
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 108 241 7.0E-07
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 146 269 8.0E-07
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 107 265 9.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 99 241 1.0E-06
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 134 282 1.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 99 241 1.0E-06
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 157 268 1.0E-06
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 145 265 2.0E-06
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 89 218 2.0E-06
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 92 241 2.0E-06
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 145 268 3.0E-06
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 89 281 3.0E-06
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 106 281 3.0E-06
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 105 219 3.0E-06
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 133 281 4.0E-06
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 75 219 4.0E-06
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 106 268 4.0E-06
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 105 282 4.0E-06
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 106 268 5.0E-06
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 87 269 7.0E-06
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 148 290 7.0E-06
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 92 283 7.0E-06
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 145 268 7.0E-06
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 122 265 7.0E-06
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 87 269 8.0E-06
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 87 269 8.0E-06
sp|Q2T9Z7|KLHL9_BOVIN Kelch-like protein 9 OS=Bos taurus GN=KLHL9 PE=2 SV=1 107 267 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2794
MAQPSTPSHHATTSSIFGGPPAHAAAPAPTQAGSGQASQAASSSAPVANAAPTPASAASSSNTYIMPNSPAKARP
LADGYRPKITRTLGQRPACLVNASVTYCGNNQIYAFGGFDQYTDEVYNHVLRLDLSCHQWSLVDNYGDIPGVRMG
HTATLYQGDKLLVFGGENEHRTYLSDLIIFDLKTAHWTQPQVSGPLPKGRARHAAVLHEDKLFIIGGITGQNNYV
LDDICYLDLRTFTWSKAWRFVGRFDHSAYIWDDRVWVFGGLSEDMDKISDLWWLDLKGSPEFDSRPHFGVFDRHS
AANRAAGSPRAPYSLASAPVVGTSGYAANSRTAQVNPPSFQLKTYAPLAPGSISALKFMSGPTIPSQGSGIHYHA
YSSGTLLDFVTPAATITPRECSLSALDLATLRWQKLAEGREIFKSGYRWHYCTMNEDGTKAWLLGCPTDPTATDL
GPNGYEEYLSDIMEIDLRRYGFLGSNMTPEPRSESRPSATTRAVDSPSKGLGTDLAKLFNQPPESGSGTDFVITA
LAEEYDEDDGQHGSSLVRAEEATGGQSWLAPDVPTSQPMHVHKLILQARWPHFARLYNSQMAEFQTKKMHIPEPY
SVVRAFLLYLYTDSIRGTAEAEGEAATELPDVAGLLVMSNIYNIPHLRLLCVNRLAKELDVEHAGRRRSA*
Coding >Hirsu2|2794
ATGGCTCAACCGTCGACTCCCAGCCACCACGCGACGACATCGTCCATCTTTGGAGGCCCGCCGGCCCACGCCGCC
GCTCCGGCCCCGACCCAAGCCGGCTCGGGCCAGGCGAGTCAGGCCGCGTCGAGCTCCGCCCCCGTCGCCAACGCT
GCGCCGACGCCGGCCTCGGCCGCCTCCTCCTCCAACACGTACATCATGCCCAACTCGCCGGCCAAGGCCCGCCCG
TTGGCGGACGGATACCGTCCCAAGATCACGCGCACCCTCGGCCAGCGGCCCGCCTGCCTGGTCAACGCATCGGTG
ACGTACTGCGGCAACAACCAGATCTATGCCTTTGGCGGCTTCGACCAGTACACCGACGAGGTTTACAACCACGTG
CTGCGGCTCGACTTGTCCTGTCACCAGTGGAGCCTGGTCGACAACTATGGGGACATTCCCGGCGTGCGGATGGGT
CACACCGCCACCTTGTACCAGGGCGACAAGCTGCTGGTTTTCGGCGGCGAGAACGAGCACCGGACGTACCTGTCG
GACCTCATCATCTTCGATCTCAAGACGGCGCACTGGACGCAGCCGCAGGTTTCCGGTCCGCTCCCCAAGGGCCGG
GCCCGGCACGCGGCAGTTCTACACGAGGACAAGCTGTTCATCATCGGCGGGATCACGGGCCAGAACAACTATGTG
TTGGACGACATCTGCTACCTGGACCTGCGGACCTTTACCTGGTCCAAGGCCTGGCGCTTCGTCGGCCGGTTCGAC
CACTCGGCATACATCTGGGACGATCGGGTCTGGGTCTTCGGCGGCCTTAGCGAGGACATGGACAAGATCAGCGAT
CTCTGGTGGCTCGACCTGAAGGGGAGCCCCGAGTTCGACTCACGCCCGCACTTTGGCGTCTTCGACCGCCACTCG
GCTGCGAACAGGGCGGCCGGCTCGCCCCGGGCGCCGTACTCGCTGGCGTCCGCGCCCGTGGTGGGGACGTCCGGC
TACGCGGCCAACTCGCGGACGGCCCAGGTGAACCCGCCGTCCTTCCAGCTCAAGACGTACGCGCCGCTGGCGCCC
GGGTCCATCTCGGCTTTAAAGTTCATGTCGGGCCCGACGATCCCGTCGCAGGGCTCCGGCATCCACTACCACGCA
TACTCGTCGGGGACGCTACTCGACTTCGTCACGCCGGCGGCGACCATCACGCCGCGCGAATGCTCCCTCTCAGCC
CTGGACCTGGCCACGCTGCGATGGCAGAAACTGGCCGAGGGGCGCGAGATTTTTAAGTCGGGATACCGGTGGCAC
TACTGCACGATGAATGAGGACGGCACCAAGGCCTGGCTCCTAGGCTGTCCGACAGACCCGACGGCGACGGACCTC
GGACCGAACGGCTACGAGGAATACCTGAGCGACATCATGGAGATCGACCTCCGCCGATACGGCTTCCTCGGCAGC
AATATGACGCCGGAGCCACGGAGTGAGTCACGGCCGTCGGCGACGACACGGGCGGTCGACTCACCGTCCAAGGGG
CTGGGCACCGACCTGGCCAAGCTATTCAACCAGCCGCCGGAGTCGGGCAGCGGGACGGACTTCGTCATCACGGCG
CTGGCGGAGGAGTACGACGAGGACGACGGGCAGCACGGGTCGAGCCTGGTCCGAGCGGAGGAGGCGACGGGCGGG
CAGAGCTGGCTGGCGCCGGACGTGCCGACGTCGCAGCCGATGCACGTGCACAAGCTGATCTTGCAGGCGCGGTGG
CCGCACTTTGCGCGGCTGTACAACTCGCAGATGGCCGAGTTCCAGACGAAGAAGATGCACATACCGGAGCCGTAC
TCGGTGGTGCGGGCCTTCCTGCTGTACCTGTACACGGACAGCATCCGCGGGACGGCGGAGGCGGAGGGCGAGGCG
GCGACGGAGCTGCCGGACGTGGCGGGCCTGCTGGTCATGTCCAACATCTACAACATCCCGCACCTGCGGCTGCTG
TGCGTCAACCGGCTGGCCAAGGAGCTGGACGTGGAGCACGCCGGGCGGCGACGTTCTGCATGA
Transcript >Hirsu2|2794
ATGGCTCAACCGTCGACTCCCAGCCACCACGCGACGACATCGTCCATCTTTGGAGGCCCGCCGGCCCACGCCGCC
GCTCCGGCCCCGACCCAAGCCGGCTCGGGCCAGGCGAGTCAGGCCGCGTCGAGCTCCGCCCCCGTCGCCAACGCT
GCGCCGACGCCGGCCTCGGCCGCCTCCTCCTCCAACACGTACATCATGCCCAACTCGCCGGCCAAGGCCCGCCCG
TTGGCGGACGGATACCGTCCCAAGATCACGCGCACCCTCGGCCAGCGGCCCGCCTGCCTGGTCAACGCATCGGTG
ACGTACTGCGGCAACAACCAGATCTATGCCTTTGGCGGCTTCGACCAGTACACCGACGAGGTTTACAACCACGTG
CTGCGGCTCGACTTGTCCTGTCACCAGTGGAGCCTGGTCGACAACTATGGGGACATTCCCGGCGTGCGGATGGGT
CACACCGCCACCTTGTACCAGGGCGACAAGCTGCTGGTTTTCGGCGGCGAGAACGAGCACCGGACGTACCTGTCG
GACCTCATCATCTTCGATCTCAAGACGGCGCACTGGACGCAGCCGCAGGTTTCCGGTCCGCTCCCCAAGGGCCGG
GCCCGGCACGCGGCAGTTCTACACGAGGACAAGCTGTTCATCATCGGCGGGATCACGGGCCAGAACAACTATGTG
TTGGACGACATCTGCTACCTGGACCTGCGGACCTTTACCTGGTCCAAGGCCTGGCGCTTCGTCGGCCGGTTCGAC
CACTCGGCATACATCTGGGACGATCGGGTCTGGGTCTTCGGCGGCCTTAGCGAGGACATGGACAAGATCAGCGAT
CTCTGGTGGCTCGACCTGAAGGGGAGCCCCGAGTTCGACTCACGCCCGCACTTTGGCGTCTTCGACCGCCACTCG
GCTGCGAACAGGGCGGCCGGCTCGCCCCGGGCGCCGTACTCGCTGGCGTCCGCGCCCGTGGTGGGGACGTCCGGC
TACGCGGCCAACTCGCGGACGGCCCAGGTGAACCCGCCGTCCTTCCAGCTCAAGACGTACGCGCCGCTGGCGCCC
GGGTCCATCTCGGCTTTAAAGTTCATGTCGGGCCCGACGATCCCGTCGCAGGGCTCCGGCATCCACTACCACGCA
TACTCGTCGGGGACGCTACTCGACTTCGTCACGCCGGCGGCGACCATCACGCCGCGCGAATGCTCCCTCTCAGCC
CTGGACCTGGCCACGCTGCGATGGCAGAAACTGGCCGAGGGGCGCGAGATTTTTAAGTCGGGATACCGGTGGCAC
TACTGCACGATGAATGAGGACGGCACCAAGGCCTGGCTCCTAGGCTGTCCGACAGACCCGACGGCGACGGACCTC
GGACCGAACGGCTACGAGGAATACCTGAGCGACATCATGGAGATCGACCTCCGCCGATACGGCTTCCTCGGCAGC
AATATGACGCCGGAGCCACGGAGTGAGTCACGGCCGTCGGCGACGACACGGGCGGTCGACTCACCGTCCAAGGGG
CTGGGCACCGACCTGGCCAAGCTATTCAACCAGCCGCCGGAGTCGGGCAGCGGGACGGACTTCGTCATCACGGCG
CTGGCGGAGGAGTACGACGAGGACGACGGGCAGCACGGGTCGAGCCTGGTCCGAGCGGAGGAGGCGACGGGCGGG
CAGAGCTGGCTGGCGCCGGACGTGCCGACGTCGCAGCCGATGCACGTGCACAAGCTGATCTTGCAGGCGCGGTGG
CCGCACTTTGCGCGGCTGTACAACTCGCAGATGGCCGAGTTCCAGACGAAGAAGATGCACATACCGGAGCCGTAC
TCGGTGGTGCGGGCCTTCCTGCTGTACCTGTACACGGACAGCATCCGCGGGACGGCGGAGGCGGAGGGCGAGGCG
GCGACGGAGCTGCCGGACGTGGCGGGCCTGCTGGTCATGTCCAACATCTACAACATCCCGCACCTGCGGCTGCTG
TGCGTCAACCGGCTGGCCAAGGAGCTGGACGTGGAGCACGCCGGGCGGCGACGTTCTGCATGA
Gene >Hirsu2|2794
ATGGCTCAACCGTCGACTCCCAGCCACCACGCGACGACATCGTCCATCTTTGGAGGCCCGCCGGCCCACGCCGCC
GCTCCGGCCCCGACCCAAGCCGGCTCGGGCCAGGCGAGTCAGGCCGCGTCGAGCTCCGCCCCCGTCGCCAACGCT
GCGCCGACGCCGGCCTCGGCCGCCTCCTCCTCCAACACGTACATCATGCCCAACTCGCCGGCCAAGGCCCGCCCG
TTGGCGGACGGATACCGTCCCAAGATCACGCGCACCCTCGGCCAGCGGCCCGCCTGCCTGGTCAACGCATCGGTG
ACGTACTGCGGCAACAACCAGATCTATGCCTTTGGCGGCTTCGACCAGTACACCGACGAGGTTTACAACCACGTG
CTGCGGCTCGACTTGTCCTGTCACCAGTGGAGCCTGGTCGACAACTATGGGGACATTCCCGGCGTGCGGATGGGT
ACATAGCAGGCCCCCCTTTTTGCCCTGCCTGTCAGAGCATCGTCGTTTCTGACACGGGGATACATATATATATAG
GTCACACCGCCACCTTGTACCAGGGCGACAAGCTGCTGGTTTTCGGCGGCGAGAACGAGCACCGGACGTACCTGT
CGGACCTCATCATCTTCGATCTCAAGACGGCGCACTGGACGCAGCCGCAGGTTTCCGGTCCGCTCCCCAAGGGCC
GGGCCCGGCACGCGGCAGTTCTACACGAGGACAAGCTGTTCATCATCGGCGGGATCACGGGCCAGAACAACTATG
TGTTGGACGACATCTGCTACCTGGACCTGCGGACCTTTACCTGGTCCAAGGCCTGGCGCTTCGTCGGCCGGTTCG
ACCACTCGGCATACATCTGGGACGATCGGGTCTGGGTCTTCGGCGGCCTTAGCGAGGACATGGACAAGATCAGCG
ATCTCTGGTGGCTCGACCTGAAGGGGAGCCCCGAGTTCGACTCACGCCCGCACTTTGGCGTCTTCGACCGCCACT
CGGCTGCGAACAGGGCGGCCGGCTCGCCCCGGGCGCCGTACTCGCTGGCGTCCGCGCCCGTGGTGGGGACGTCCG
GCTACGCGGCCAACTCGCGGACGGCCCAGGTGAACCCGCCGTCCTTCCAGCTCAAGACGTACGCGCCGCTGGCGC
CCGGGTCCATCTCGGCTTTAAAGTTCATGTCGGGCCCGACGATCCCGTCGCAGGGCTCCGGCATCCACTACCACG
CATACTCGTCGGGGACGCTACTCGACTTCGTCACGCCGGCGGCGACCATCACGCCGCGCGAATGCTCCCTCTCAG
CCCTGGACCTGGCCACGCTGCGATGGCAGAAACTGGCCGAGGGGCGCGAGATTTTTAAGTCGGGATACCGGTGGC
ACTACTGCACGATGAATGAGGACGGCACCAAGGCCTGGCTCCTAGGCTGTCCGACAGACCCGACGGCGACGGACC
TCGGACCGAACGGCTACGAGGAATACCTGAGGTGAGTCATCGTGACTAGATCCCCCCCCTCCGAAACACCCAAAC
AAGTCTAAGATGGGCCGGCCACACACAGCGACATCATGGAGATCGACCTCCGCCGATACGGCTTCCTCGGCAGCA
ATATGACGCCGGAGCCACGGAGTGAGTCACGGCCGTCGGCGACGACACGGGCGGTCGACTCACCGTCCAAGGGGC
TGGGCACCGACCTGGCCAAGCTATTCAACCAGCCGCCGGAGTCGGGCAGCGGGACGGACTTCGTCATCACGGCGC
TGGCGGAGGAGTACGACGAGGACGACGGGCAGCACGGGTCGAGCCTGGTCCGAGCGGAGGAGGCGACGGGCGGGC
AGAGCTGGCTGGCGCCGGACGTGCCGACGTCGCAGCCGATGCACGTGCACAAGCTGATCTTGCAGGCGCGGTGGC
CGCACTTTGCGCGGCTGTACAACTCGCAGATGGCCGAGTTCCAGACGAAGAAGATGCACATACCGGAGCCGTACT
CGGTGGTGCGGGCCTTCCTGCTGTACCTGTACACGGACAGCATCCGCGGGACGGCGGAGGCGGAGGGCGAGGCGG
CGACGGAGCTGCCGGACGTGGCGGGCCTGCTGGTCATGTCCAACATCTACAACATCCCGCACCTGCGGCTGCTGT
GCGTCAACCGGCTGGCCAAGGAGCTGGACGTGGAGCACGCGTGCGTCATCTGGTACTGCGCGGGGCTGGCGAGCG
AGGAGTGGCTGCGCAAGCGGGCGGCGACGTTCTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail