Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|278
Gene name
LocationContig_1050:5600..6881
Strand-
Gene length (bp)1281
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.2E-09 288 403
PF00042 Globin Globin 3.4E-09 7 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7TTP0|HMP_BORPE Flavohemoprotein OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hmp PE=3 SV=1 3 426 3.0E-103
sp|Q7TTP2|HMP_BORPA Flavohemoprotein OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hmp PE=3 SV=1 3 426 5.0E-103
sp|Q7WHW5|HMP_BORBR Flavohemoprotein OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hmp PE=3 SV=1 3 426 5.0E-103
sp|Q7WUM8|HMP_RHIME Flavohemoprotein OS=Rhizobium meliloti (strain 1021) GN=hmp PE=3 SV=2 3 421 2.0E-101
sp|P39662|HMP_CUPNH Flavohemoprotein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hmp PE=1 SV=2 3 421 1.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7TTP0|HMP_BORPE Flavohemoprotein OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hmp PE=3 SV=1 3 426 3.0E-103
sp|Q7TTP2|HMP_BORPA Flavohemoprotein OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hmp PE=3 SV=1 3 426 5.0E-103
sp|Q7WHW5|HMP_BORBR Flavohemoprotein OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hmp PE=3 SV=1 3 426 5.0E-103
sp|Q7WUM8|HMP_RHIME Flavohemoprotein OS=Rhizobium meliloti (strain 1021) GN=hmp PE=3 SV=2 3 421 2.0E-101
sp|P39662|HMP_CUPNH Flavohemoprotein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hmp PE=1 SV=2 3 421 1.0E-99
sp|Q7NSD8|HMP_CHRVO Flavohemoprotein OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hmp PE=3 SV=1 3 423 3.0E-96
sp|Q9RYR5|HMP_DEIRA Flavohemoprotein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hmp PE=3 SV=1 3 422 3.0E-96
sp|P40609|HMP_VIBPA Flavohemoprotein OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmp PE=3 SV=2 3 426 3.0E-92
sp|Q6LM37|HMP_PHOPR Flavohemoprotein OS=Photobacterium profundum GN=hmp PE=3 SV=1 3 426 4.0E-87
sp|Q9RC40|HMP_BACHD Flavohemoprotein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hmp PE=3 SV=1 2 421 1.0E-86
sp|Q8DCU2|HMP_VIBVU Flavohemoprotein OS=Vibrio vulnificus (strain CMCP6) GN=hmp PE=3 SV=1 3 426 2.0E-85
sp|Q8ZCR0|HMP_YERPE Flavohemoprotein OS=Yersinia pestis GN=hmp PE=3 SV=1 3 426 4.0E-85
sp|Q7MH09|HMP_VIBVY Flavohemoprotein OS=Vibrio vulnificus (strain YJ016) GN=hmp PE=3 SV=1 3 426 1.0E-84
sp|Q8ETH0|HMP_OCEIH Flavohemoprotein OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hmp PE=3 SV=1 10 421 9.0E-84
sp|Q73B49|HMP_BACC1 Flavohemoprotein OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hmp PE=3 SV=1 3 421 2.0E-82
sp|Q81FW4|HMP_BACCR Flavohemoprotein OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hmp PE=3 SV=1 3 421 2.0E-81
sp|Q7N215|HMP_PHOLL Flavohemoprotein OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmp PE=3 SV=1 3 426 7.0E-81
sp|Q6HLA6|HMP_BACHK Flavohemoprotein OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hmp PE=3 SV=1 3 421 5.0E-80
sp|Q7UIY1|HMP_RHOBA Flavohemoprotein OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hmp PE=3 SV=2 3 425 9.0E-80
sp|Q81T23|HMP_BACAN Flavohemoprotein OS=Bacillus anthracis GN=hmp PE=3 SV=1 3 421 4.0E-79
sp|P49852|HMP_BACSU Flavohemoprotein OS=Bacillus subtilis (strain 168) GN=hmp PE=2 SV=1 3 421 4.0E-79
sp|Q7ABK6|HMP_ECO57 Flavohemoprotein OS=Escherichia coli O157:H7 GN=hmp PE=3 SV=1 3 426 4.0E-79
sp|Q8FF30|HMP_ECOL6 Flavohemoprotein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hmp PE=3 SV=1 3 426 7.0E-79
sp|Q7C0F9|HMP_SHIFL Flavohemoprotein OS=Shigella flexneri GN=hmp PE=3 SV=1 3 426 8.0E-79
sp|P24232|HMP_ECOLI Flavohemoprotein OS=Escherichia coli (strain K12) GN=hmp PE=1 SV=1 3 426 1.0E-78
sp|Q5PIH6|HMP_SALPA Flavohemoprotein OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hmp PE=3 SV=1 3 426 2.0E-78
sp|P26353|HMP_SALTY Flavohemoprotein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hmp PE=2 SV=3 3 426 5.0E-78
sp|Q9KMY3|HMP_VIBCH Flavohemoprotein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hmp PE=1 SV=1 3 421 5.0E-78
sp|Q8Z4M3|HMP_SALTI Flavohemoprotein OS=Salmonella typhi GN=hmp PE=3 SV=1 3 426 5.0E-78
sp|Q57LF5|HMP_SALCH Flavohemoprotein OS=Salmonella choleraesuis (strain SC-B67) GN=hmp PE=3 SV=1 3 426 9.0E-78
sp|Q9UAG7|FHBA_DICDI Flavohemoprotein A OS=Dictyostelium discoideum GN=fhbA PE=2 SV=1 1 421 4.0E-76
sp|Q6D245|HMP_PECAS Flavohemoprotein OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hmp PE=3 SV=1 3 426 9.0E-76
sp|Q88PP0|HMP_PSEPK Flavohemoprotein OS=Pseudomonas putida (strain KT2440) GN=hmp PE=3 SV=1 3 422 7.0E-75
sp|Q9I0H4|HMP_PSEAE Flavohemoprotein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hmp PE=3 SV=1 3 421 2.0E-74
sp|Q8GAZ4|HMP_BURST Flavohemoprotein OS=Burkholderia sp. (strain TH2) GN=hmp PE=3 SV=1 3 421 8.0E-72
sp|Q47266|HMP_DICD3 Flavohemoprotein OS=Dickeya dadantii (strain 3937) GN=hmp PE=3 SV=2 3 426 4.0E-70
sp|E2RTZ4|HMP_GIAIC Flavohemoprotein OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=hmpA PE=1 SV=1 1 421 1.0E-64
sp|C6LR75|HMP_GIAIB Flavohemoprotein OS=Giardia intestinalis (strain ATCC 50581 / GS clone H7) GN=hmpA PE=3 SV=1 1 421 5.0E-63
sp|Q54D73|FHBB_DICDI Flavohemoprotein B OS=Dictyostelium discoideum GN=fhbB PE=1 SV=1 3 421 5.0E-61
sp|E1F8Q4|HMP1_GIAIA Flavohemoprotein-1 OS=Giardia intestinalis (strain P15) GN=hmpA-1 PE=3 SV=1 1 421 5.0E-61
sp|E1F8H4|HMP2_GIAIA Flavohemoprotein-2 OS=Giardia intestinalis (strain P15) GN=hmpA-2 PE=3 SV=1 1 421 7.0E-61
sp|Q87F90|HMP_XYLFT Flavohemoprotein OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hmp PE=3 SV=1 2 421 4.0E-58
sp|Q9PH91|HMP_XYLFA Flavohemoprotein OS=Xylella fastidiosa (strain 9a5c) GN=hmp PE=3 SV=1 2 421 6.0E-58
sp|P39676|FHP_YEAST Flavohemoprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHB1 PE=1 SV=2 9 349 2.0E-56
sp|Q9URY5|FHP_SCHPO Flavohemoprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.02c PE=3 SV=1 3 421 1.0E-52
sp|Q03331|FHP_CANNO Flavohemoprotein OS=Candida norvegensis PE=1 SV=3 3 412 5.0E-52
sp|Q59MV9|FHP_CANAL Flavohemoprotein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YHB1 PE=2 SV=1 3 411 5.0E-45
sp|P04252|BAHG_VITST Bacterial hemoglobin OS=Vitreoscilla stercoraria GN=vhb PE=1 SV=1 3 145 8.0E-34
sp|O66586|Y211_AQUAE Uncharacterized globin-like protein aq_211 OS=Aquifex aeolicus (strain VF5) GN=aq_211 PE=3 SV=1 3 144 5.0E-22
sp|P9WJ93|KSHB_MYCTU 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hmp PE=1 SV=1 157 425 5.0E-11
sp|P9WJ92|KSHB_MYCTO 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hmp PE=3 SV=1 157 425 5.0E-11
sp|A0R525|KSHB_MYCS2 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kshB PE=3 SV=1 157 425 3.0E-10
sp|P9WNE9|DESET_MYCTU Stearoyl-CoA 9-desaturase electron transfer partner OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3230c PE=1 SV=1 165 426 3.0E-10
sp|P9WNE8|DESET_MYCTO Stearoyl-CoA 9-desaturase electron transfer partner OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3327 PE=3 SV=1 165 426 3.0E-10
sp|Q44257|CBAB_COMTE 3-chlorobenzoate-3,4-dioxygenase reductase subunit OS=Comamonas testosteroni GN=cbaB PE=3 SV=2 150 401 1.0E-09
sp|H9N291|NDMD_PSEPU Oxidoreductase NdmD OS=Pseudomonas putida GN=ndmD PE=3 SV=1 159 422 1.0E-08
sp|Q9AHG2|TSAB2_COMTE Putative toluene-4-sulfonate monooxygenase system reductase subunit TsaB2 OS=Comamonas testosteroni GN=tsaB2 PE=5 SV=1 170 304 2.0E-06
sp|Q9CLA6|NQRF_PASMU Na(+)-translocating NADH-quinone reductase subunit F OS=Pasteurella multocida (strain Pm70) GN=nqrF PE=3 SV=1 260 421 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0020037 heme binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0046906 tetrapyrrole binding No
GO:1901363 heterocyclic compound binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|278
MALTPEQIAIVKSTAPIIKEHGKTITTVFYDRMLAAHPELKNYFSLRHQQVGAQQAALADAVFAYAAYIDDLPKL
KGAVERIAHKHASLFVRADQYPIVGKFLVAAFAEVLGDALTADVADAWVAAYGQLADVFIGRERQLYDESARRDD
WSDWRAFTIADRVAEADDVVSFYLRPADGRPLPGYRPGQYVSVRIPIPELGGLFQIRQFSLSLAPDEAMASYRVS
VKREETVDGPSVDDLAEGKVPGLISNRLHGQYAVGDTLELSPPRGEFFFDADAVPADAPVVLLSIGVGATPMLSI
LQSIVDSPSPAAARRPVSWVHAARYSGGVCFRGPVRDLAAKHDNIKPVLFVKNVAKGDEKGREYDAEGRLSLDEA
ERMALLHLDNASTGYYICGPEGWMAQARQWLLDRGVARERIYLELFSTGEV*
Coding >Hirsu2|278
ATGGCGTTGACCCCGGAGCAGATCGCCATCGTCAAGTCGACGGCGCCGATCATCAAGGAGCACGGCAAGACCATC
ACGACCGTCTTCTACGACCGGATGCTGGCGGCGCACCCGGAACTCAAGAACTATTTCTCGCTGAGGCACCAGCAG
GTGGGCGCACAGCAGGCGGCGCTGGCCGACGCCGTCTTCGCCTACGCCGCCTACATCGACGACCTGCCCAAGCTC
AAGGGCGCGGTGGAGCGCATCGCCCACAAGCACGCCTCGCTCTTCGTCCGGGCCGACCAGTACCCCATCGTTGGC
AAGTTCCTCGTCGCCGCCTTCGCCGAGGTGCTGGGCGACGCCCTGACGGCTGACGTGGCCGACGCCTGGGTCGCC
GCCTACGGCCAGCTCGCCGACGTCTTCATCGGGCGCGAGCGCCAGCTGTACGACGAGTCGGCCCGGCGCGACGAC
TGGTCCGACTGGCGTGCCTTCACCATCGCCGACCGCGTGGCCGAGGCCGACGACGTCGTCAGCTTCTACCTGCGC
CCGGCCGACGGCCGCCCGCTGCCGGGCTACCGCCCGGGCCAGTACGTCAGCGTGCGCATCCCCATCCCGGAGTTG
GGCGGCCTGTTCCAGATCCGCCAGTTCAGCCTGAGCCTGGCGCCCGACGAGGCCATGGCCTCGTACCGCGTCTCC
GTCAAGCGCGAGGAGACGGTGGACGGGCCGAGCGTCGACGACCTGGCCGAGGGCAAGGTGCCCGGCCTCATCTCC
AACCGGCTGCACGGCCAGTACGCCGTCGGCGACACGCTCGAGCTGAGCCCGCCGCGCGGCGAGTTCTTCTTCGAC
GCCGATGCCGTCCCGGCCGACGCGCCTGTTGTTCTGCTGTCCATCGGCGTCGGCGCCACGCCGATGCTGTCCATC
CTGCAGTCCATCGTCGACTCGCCGTCGCCGGCGGCCGCTCGCCGGCCCGTCAGCTGGGTCCACGCGGCGCGCTAC
TCGGGCGGCGTGTGCTTCCGCGGGCCCGTCCGGGACCTGGCCGCCAAGCACGACAACATCAAGCCCGTGCTCTTC
GTCAAGAACGTCGCAAAGGGTGACGAGAAGGGCCGCGAGTACGATGCCGAGGGCCGGCTGAGCCTCGACGAGGCC
GAGCGCATGGCCCTGCTGCACCTCGACAACGCCTCGACCGGCTACTACATCTGCGGACCCGAGGGTTGGATGGCG
CAGGCGAGGCAGTGGCTCTTGGACAGGGGCGTCGCCCGCGAGCGCATCTACCTCGAGCTGTTCAGCACCGGTGAG
GTATGA
Transcript >Hirsu2|278
ATGGCGTTGACCCCGGAGCAGATCGCCATCGTCAAGTCGACGGCGCCGATCATCAAGGAGCACGGCAAGACCATC
ACGACCGTCTTCTACGACCGGATGCTGGCGGCGCACCCGGAACTCAAGAACTATTTCTCGCTGAGGCACCAGCAG
GTGGGCGCACAGCAGGCGGCGCTGGCCGACGCCGTCTTCGCCTACGCCGCCTACATCGACGACCTGCCCAAGCTC
AAGGGCGCGGTGGAGCGCATCGCCCACAAGCACGCCTCGCTCTTCGTCCGGGCCGACCAGTACCCCATCGTTGGC
AAGTTCCTCGTCGCCGCCTTCGCCGAGGTGCTGGGCGACGCCCTGACGGCTGACGTGGCCGACGCCTGGGTCGCC
GCCTACGGCCAGCTCGCCGACGTCTTCATCGGGCGCGAGCGCCAGCTGTACGACGAGTCGGCCCGGCGCGACGAC
TGGTCCGACTGGCGTGCCTTCACCATCGCCGACCGCGTGGCCGAGGCCGACGACGTCGTCAGCTTCTACCTGCGC
CCGGCCGACGGCCGCCCGCTGCCGGGCTACCGCCCGGGCCAGTACGTCAGCGTGCGCATCCCCATCCCGGAGTTG
GGCGGCCTGTTCCAGATCCGCCAGTTCAGCCTGAGCCTGGCGCCCGACGAGGCCATGGCCTCGTACCGCGTCTCC
GTCAAGCGCGAGGAGACGGTGGACGGGCCGAGCGTCGACGACCTGGCCGAGGGCAAGGTGCCCGGCCTCATCTCC
AACCGGCTGCACGGCCAGTACGCCGTCGGCGACACGCTCGAGCTGAGCCCGCCGCGCGGCGAGTTCTTCTTCGAC
GCCGATGCCGTCCCGGCCGACGCGCCTGTTGTTCTGCTGTCCATCGGCGTCGGCGCCACGCCGATGCTGTCCATC
CTGCAGTCCATCGTCGACTCGCCGTCGCCGGCGGCCGCTCGCCGGCCCGTCAGCTGGGTCCACGCGGCGCGCTAC
TCGGGCGGCGTGTGCTTCCGCGGGCCCGTCCGGGACCTGGCCGCCAAGCACGACAACATCAAGCCCGTGCTCTTC
GTCAAGAACGTCGCAAAGGGTGACGAGAAGGGCCGCGAGTACGATGCCGAGGGCCGGCTGAGCCTCGACGAGGCC
GAGCGCATGGCCCTGCTGCACCTCGACAACGCCTCGACCGGCTACTACATCTGCGGACCCGAGGGTTGGATGGCG
CAGGCGAGGCAGTGGCTCTTGGACAGGGGCGTCGCCCGCGAGCGCATCTACCTCGAGCTGTTCAGCACCGGTGAG
GTATGA
Gene >Hirsu2|278
ATGGCGTTGACCCCGGAGCAGATCGCCATCGTCAAGTCGACGGCGCCGATCATCAAGGAGCACGGCAAGACCATC
ACGACCGTCTTCTACGACCGGATGCTGGCGGCGCACCCGGAACTCAAGAACTATTTCTCGCTGAGGCACCAGCAG
GTGGGCGCACAGCAGGCGGCGCTGGCCGACGCCGTCTTCGCCTACGCCGCCTACATCGACGACCTGCCCAAGCTC
AAGGGCGCGGTGGAGCGCATCGCCCACAAGCACGCCTCGCTCTTCGTCCGGGCCGACCAGTACCCCATCGTTGGC
AAGTTCCTCGTCGCCGCCTTCGCCGAGGTGCTGGGCGACGCCCTGACGGCTGACGTGGCCGACGCCTGGGTCGCC
GCCTACGGCCAGCTCGCCGACGTCTTCATCGGGCGCGAGCGCCAGCTGTACGACGAGTCGGCCCGGCGCGACGAC
TGGTCCGACTGGCGTGCCTTCACCATCGCCGACCGCGTGGCCGAGGCCGACGACGTCGTCAGCTTCTACCTGCGC
CCGGCCGACGGCCGCCCGCTGCCGGGCTACCGCCCGGGCCAGTACGTCAGCGTGCGCATCCCCATCCCGGAGTTG
GGCGGCCTGTTCCAGATCCGCCAGTTCAGCCTGAGCCTGGCGCCCGACGAGGCCATGGCCTCGTACCGCGTCTCC
GTCAAGCGCGAGGAGACGGTGGACGGGCCGAGCGTCGACGACCTGGCCGAGGGCAAGGTGCCCGGCCTCATCTCC
AACCGGCTGCACGGCCAGTACGCCGTCGGCGACACGCTCGAGCTGAGCCCGCCGCGCGGCGAGTTCTTCTTCGAC
GCCGATGCCGTCCCGGCCGACGCGCCTGTTGTTCTGCTGTCCATCGGCGTCGGCGCCACGCCGATGCTGTCCATC
CTGCAGTCCATCGTCGACTCGCCGTCGCCGGCGGCCGCTCGCCGGCCCGTCAGCTGGGTCCACGCGGCGCGCTAC
TCGGGCGGCGTGTGCTTCCGCGGGCCCGTCCGGGACCTGGCCGCCAAGCACGACAACATCAAGCCCGTGCTCTTC
GTCAAGAACGTCGCAAAGGGTGACGAGAAGGGCCGCGAGTACGATGCCGAGGGCCGGCTGAGCCTCGACGAGGCC
GAGCGCATGGCCCTGCTGCACCTCGACAACGCCTCGACCGGCTACTACATCTGCGGACCCGAGGGTTGGATGGCG
CAGGCGAGGCAGTGGCTCTTGGACAGGGGCGTCGCCCGCGAGCGCATCTACCTCGAGCTGTTCAGCACCGGTGAG
GTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail