Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2779
Gene name
LocationContig_1688:2629..4622
Strand+
Gene length (bp)1993
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08316 Pal1 Pal1 cell morphology protein 9.6E-48 236 370

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38809|YHP7_YEAST Uncharacterized protein YHR097C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR097C PE=1 SV=1 223 399 3.0E-23
sp|Q9UU83|PAL1_SCHPO Protein pal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pal1 PE=1 SV=1 213 423 5.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2779
MSFPANPLQTGQLPAASQPSPNLSSNNPFRNRTASPPSSDAAFVSPASPFEDPPRRPQSRNPFFEPPPVKSPPAM
ASHGNSKSLSAEEIFDSLTLDEKKGQNRPLAAPPPPQRHPTDPSTSRRGESKPLIKPSKGSHRPTRSQEEALRAR
KPLAGGQKPGPSESPQRKHSSRPRRNSESSVLDLSSQPITAEEMKMIEAKRLRDKQRRERDGRSSGRDARDGKER
SKSRRPSRRLDIIDQLDATSIYGTGLFHHDGPFDALNPHRNRLNSRRAPMQAFPKDSLNNSIGGAGPLNRNPDHA
VFMGNGTDEAFRDYAGGGKNKNGYNYPGPSSGEAAIFDPISRGSVVHGDESVGLGTSTFLEGTPAARTAIARREA
EQAQELVEGGIQRKKSLAQRIRHINKGQRDFTPSGRVTNPESAYARHSPDHVASAGSVPSDSNPFFAEFSKGEET
ISVRPRDGTMSPNSPPRVPRRMSGGAVERRSQADGADEANAKPSGILGRMKSLKGGRKPRTSDHGPSQSSGAAI*
Coding >Hirsu2|2779
ATGTCCTTCCCGGCAAACCCTTTGCAGACAGGCCAACTGCCAGCTGCTTCTCAGCCCTCCCCCAACCTCTCCTCC
AACAACCCCTTTCGCAACCGCACCGCCTCGCCCCCGAGCTCCGACGCCGCCTTCGTCTCGCCTGCCTCGCCCTTC
GAGGACCCCCCGCGTCGGCCTCAATCGCGAAATCCTTTCTTCGAGCCGCCACCCGTCAAGTCGCCGCCCGCCATG
GCGAGCCACGGCAACTCCAAGTCCCTCTCGGCCGAGGAGATATTCGACTCGTTGACCCTCGACGAGAAAAAGGGT
CAGAACAGGCCGCTTGCTGCTCCTCCCCCGCCGCAACGCCACCCGACGGACCCGTCCACCTCTCGTCGAGGAGAG
AGCAAGCCCCTCATCAAGCCGTCCAAGGGCAGCCACAGACCTACCCGATCGCAAGAAGAGGCCTTGCGGGCCCGC
AAGCCGCTCGCCGGCGGCCAGAAGCCCGGCCCGTCTGAGTCTCCCCAGCGAAAGCACTCGTCGCGCCCCAGGCGC
AACTCGGAATCCTCCGTCTTGGACCTCAGCAGCCAGCCAATCACGGCGGAGGAGATGAAGATGATCGAAGCCAAG
CGGCTCCGCGACAAGCAGCGTCGGGAGCGCGACGGGCGCTCCTCGGGCCGCGACGCTCGCGATGGCAAGGAGCGG
AGCAAGTCGAGGCGGCCGAGTCGCCGCTTGGACATCATCGACCAGCTCGACGCCACCAGCATCTACGGAACAGGA
TTGTTTCACCACGACGGCCCCTTCGACGCCTTGAACCCCCACCGCAACCGCCTCAACAGCCGGAGGGCACCCATG
CAGGCGTTCCCCAAGGACTCCCTCAACAACTCCATCGGTGGCGCCGGTCCCCTGAACCGAAACCCCGACCACGCC
GTCTTCATGGGGAACGGAACGGACGAGGCCTTCCGCGACTACGCCGGGGGCGGTAAGAACAAGAATGGCTACAAC
TACCCGGGCCCCTCGAGCGGCGAGGCTGCCATCTTCGACCCCATCTCGCGCGGCTCCGTCGTCCACGGCGACGAG
AGCGTCGGCCTGGGCACATCGACCTTCCTCGAGGGAACGCCGGCCGCGAGAACGGCTATCGCCCGGCGGGAGGCT
GAGCAGGCGCAGGAGCTTGTCGAGGGCGGCATCCAGCGCAAGAAGTCGCTCGCGCAACGCATCCGGCATATCAAC
AAGGGCCAGCGCGACTTCACGCCCTCTGGCCGGGTGACGAACCCGGAGAGCGCGTACGCCAGGCACTCGCCGGAC
CACGTGGCCTCGGCCGGCAGCGTCCCGAGCGACTCGAACCCGTTCTTCGCGGAGTTCAGCAAGGGCGAGGAGACG
ATCAGCGTCAGGCCCCGAGACGGCACCATGTCGCCCAACAGCCCGCCGCGGGTGCCGCGCAGGATGTCGGGCGGG
GCCGTGGAGCGACGGAGCCAGGCGGACGGGGCCGACGAGGCCAACGCCAAGCCGTCGGGGATCCTGGGCCGGATG
AAGAGCCTGAAGGGCGGGCGAAAGCCGCGAACCTCGGACCACGGCCCGTCGCAGAGCTCGGGTGCGGCCATTTGA
Transcript >Hirsu2|2779
ATGTCCTTCCCGGCAAACCCTTTGCAGACAGGCCAACTGCCAGCTGCTTCTCAGCCCTCCCCCAACCTCTCCTCC
AACAACCCCTTTCGCAACCGCACCGCCTCGCCCCCGAGCTCCGACGCCGCCTTCGTCTCGCCTGCCTCGCCCTTC
GAGGACCCCCCGCGTCGGCCTCAATCGCGAAATCCTTTCTTCGAGCCGCCACCCGTCAAGTCGCCGCCCGCCATG
GCGAGCCACGGCAACTCCAAGTCCCTCTCGGCCGAGGAGATATTCGACTCGTTGACCCTCGACGAGAAAAAGGGT
CAGAACAGGCCGCTTGCTGCTCCTCCCCCGCCGCAACGCCACCCGACGGACCCGTCCACCTCTCGTCGAGGAGAG
AGCAAGCCCCTCATCAAGCCGTCCAAGGGCAGCCACAGACCTACCCGATCGCAAGAAGAGGCCTTGCGGGCCCGC
AAGCCGCTCGCCGGCGGCCAGAAGCCCGGCCCGTCTGAGTCTCCCCAGCGAAAGCACTCGTCGCGCCCCAGGCGC
AACTCGGAATCCTCCGTCTTGGACCTCAGCAGCCAGCCAATCACGGCGGAGGAGATGAAGATGATCGAAGCCAAG
CGGCTCCGCGACAAGCAGCGTCGGGAGCGCGACGGGCGCTCCTCGGGCCGCGACGCTCGCGATGGCAAGGAGCGG
AGCAAGTCGAGGCGGCCGAGTCGCCGCTTGGACATCATCGACCAGCTCGACGCCACCAGCATCTACGGAACAGGA
TTGTTTCACCACGACGGCCCCTTCGACGCCTTGAACCCCCACCGCAACCGCCTCAACAGCCGGAGGGCACCCATG
CAGGCGTTCCCCAAGGACTCCCTCAACAACTCCATCGGTGGCGCCGGTCCCCTGAACCGAAACCCCGACCACGCC
GTCTTCATGGGGAACGGAACGGACGAGGCCTTCCGCGACTACGCCGGGGGCGGTAAGAACAAGAATGGCTACAAC
TACCCGGGCCCCTCGAGCGGCGAGGCTGCCATCTTCGACCCCATCTCGCGCGGCTCCGTCGTCCACGGCGACGAG
AGCGTCGGCCTGGGCACATCGACCTTCCTCGAGGGAACGCCGGCCGCGAGAACGGCTATCGCCCGGCGGGAGGCT
GAGCAGGCGCAGGAGCTTGTCGAGGGCGGCATCCAGCGCAAGAAGTCGCTCGCGCAACGCATCCGGCATATCAAC
AAGGGCCAGCGCGACTTCACGCCCTCTGGCCGGGTGACGAACCCGGAGAGCGCGTACGCCAGGCACTCGCCGGAC
CACGTGGCCTCGGCCGGCAGCGTCCCGAGCGACTCGAACCCGTTCTTCGCGGAGTTCAGCAAGGGCGAGGAGACG
ATCAGCGTCAGGCCCCGAGACGGCACCATGTCGCCCAACAGCCCGCCGCGGGTGCCGCGCAGGATGTCGGGCGGG
GCCGTGGAGCGACGGAGCCAGGCGGACGGGGCCGACGAGGCCAACGCCAAGCCGTCGGGGATCCTGGGCCGGATG
AAGAGCCTGAAGGGCGGGCGAAAGCCGCGAACCTCGGACCACGGCCCGTCGCAGAGCTCGGGTGCGGCCATTTGA
Gene >Hirsu2|2779
ATGTCCTTCCCGGCAAACCCTTTGCAGACAGGTGAGCCCCGCAGCCCCCGTTTGATTTCCATTCCTTACGCCTCG
AGTTTCTGCTCCTGAACCCTGGCCGCCATTCTCCCTCGCCAACAAGGGAGCAGCGCAGCAGCAGCGCCTGCTAGG
GGGATGATCATCGGTCCACTCATCGGCCGCCCTCCCTCTGCTGTGTCATCAAGCGGAGGAGATTGCCGTGTTTCA
TGTGCATCTCTGCATCGCACCGAGCCGCCGGCTGATCATCTTGTCGACTAGGCCAACTGCCAGCTGCTTCTCAGC
CCTCCCCCAACCTCTCCTCCAACAACCCCTTTCGCAACCGCACCGCCTCGCCCCCGAGCTCCGACGCCGCCTTCG
TCTCGCCTGCCTCGCCCTTCGAGGACCCCCCGCGTCGGCCTCAATCGCGAAATCCTTTCTTCGAGCCGCCACCCG
TCAAGTCGCCGCCCGCCATGGCGAGCCACGGCAACTCCAAGTCCCTCTCGGCCGAGGAGATATTCGTACGTCGAC
GCCCTCTCGGCCCCCCACGCCCTGTCGACGGTGGCTGCTCTTCCCGACCGTGACGCCGCCCGTGACGGGCCCGCC
CCGAGAGACGTGTGTGCGCTGACAGCCCTCGCCAGGACTCGTTGACCCTCGACGAGAAAAAGGGTCAGAACAGGC
CGCTTGCTGCTCCTCCCCCGCCGCAACGCCACCCGACGGACCCGTCCACCTCTCGTCGAGGAGAGAGCAAGCCCC
TCATCAAGCCGTCCAAGGGCAGCCACAGACCTACCCGATCGCAAGAAGAGGCCTTGCGGGCCCGCAAGCCGCTCG
CCGGCGGCCAGAAGCCCGGCCCGTCTGAGTCTCCCCAGCGAAAGCACTCGTCGCGCCCCAGGCGCAACTCGGAAT
CCTCCGTCTTGGACCTCAGCAGCCAGCCAATCACGGCGGAGGAGATGAAGATGATCGAAGCCAAGCGGCTCCGCG
ACAAGCAGCGTCGGGAGCGCGACGGGCGCTCCTCGGGCCGCGACGCTCGCGATGGCAAGGAGCGGAGCAAGTCGA
GGCGGCCGAGTCGCCGCTTGGACATCATCGACCAGCTCGACGCCACCAGCATCTACGGAACAGGATGTATGCGAA
GCCCGCCACCCAACCCAACGATGGCCACGTGCTGACTTGCCCAGTGTTTCACCACGACGGCCCCTTCGACGCCTT
GAACCCCCACCGCAACCGCCTCAACAGCCGGAGGGCACCCATGCAGGCGTTCCCCAAGGACTCCCTCAACAACTC
CATCGGTGGCGCCGGTCCCCTGAACCGAAACCCCGACCACGCCGTCTTCATGGGGAACGGAACGGACGAGGCCTT
CCGCGACTACGCCGGGGGCGGTAAGAACAAGAATGGCTACAACTACCCGGGCCCCTCGAGCGGCGAGGCTGCCAT
CTTCGACCCCATCTCGCGCGGCTCCGTCGTCCACGGCGACGAGAGCGTCGGCCTGGGCACATCGACCTTCCTCGA
GGGAACGCCGGCCGCGAGAACGGCTATCGCCCGGCGGGAGGCTGAGCAGGCGCAGGAGCTTGTCGAGGGCGGCAT
CCAGCGCAAGAAGTCGCTCGCGCAACGCATCCGGCATATCAACAAGGGCCAGCGCGACTTCACGCCCTCTGGCCG
GGTGACGAACCCGGAGAGCGCGTACGCCAGGCACTCGCCGGACCACGTGGCCTCGGCCGGCAGCGTCCCGAGCGA
CTCGAACCCGTTCTTCGCGGAGTTCAGCAAGGGCGAGGAGACGATCAGCGTCAGGCCCCGAGACGGCACCATGTC
GCCCAACAGCCCGCCGCGGGTGCCGCGCAGGATGTCGGGCGGGGCCGTGGAGCGACGGAGCCAGGCGGACGGGGC
CGACGAGGCCAACGCCAAGCCGTCGGGGATCCTGGGCCGGATGAAGAGCCTGAAGGGCGGGCGAAAGCCGCGAAC
CTCGGACCACGGCCCGTCGCAGAGCTCGGGTGCGGCCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail